BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 039949
(147 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3I4J|A Chain A, Crystal Structure Of Aminotransferase, Class Iii From
Deinococcus Radiodurans
pdb|3I4J|B Chain B, Crystal Structure Of Aminotransferase, Class Iii From
Deinococcus Radiodurans
pdb|3I4J|C Chain C, Crystal Structure Of Aminotransferase, Class Iii From
Deinococcus Radiodurans
pdb|3I4J|D Chain D, Crystal Structure Of Aminotransferase, Class Iii From
Deinococcus Radiodurans
Length = 430
Score = 30.0 bits (66), Expect = 0.51, Method: Compositional matrix adjust.
Identities = 13/36 (36%), Positives = 23/36 (63%)
Query: 19 FIVTSAGFVSSDFNQGRKECGDQLADFSACLPFVGG 54
++ S+G + ++ GR E G+++A +A LPFV G
Sbjct: 31 YLDGSSGALVANIGHGRAEVGERMAAQAARLPFVHG 66
>pdb|1FK0|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Capric Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK1|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Lauric Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK2|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Myristic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK3|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Palmitoleic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK4|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Stearic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK5|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Oleic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK6|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Alpha-Linolenic
Acid Revealed By High-Resolution X-Ray Crystallography
pdb|1FK7|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Ricinoleic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1AFH|A Chain A, Lipid Transfer Protein From Maize Seedlings, Nmr, 15
Structures
pdb|1MZL|A Chain A, Maize Nonspecific Lipid Transfer Protein
pdb|1MZM|A Chain A, Maize Nonspecific Lipid Transfer Protein Complexed With
Palmitate
Length = 93
Score = 26.9 bits (58), Expect = 4.0, Method: Compositional matrix adjust.
Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 7/73 (9%)
Query: 37 ECGDQLADFSACLPFVGGKAKSPTPTCCSNI-----TKEGSKTRKCLCLLVKDRNDPRHG 91
CG + + C+ + G+ P+ CCS + + R+ C +K+ G
Sbjct: 3 SCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSG 62
Query: 92 FKMNATLALSLPS 104
+NA A S+PS
Sbjct: 63 --LNAGNAASIPS 73
>pdb|2ALG|A Chain A, Crystal Structure Of Peach Pru P3, The Prototypic Member
Of The Family Of Plant Non-Specific Lipid Transfer
Protein Pan-Allergens
pdb|2ALG|B Chain B, Crystal Structure Of Peach Pru P3, The Prototypic Member
Of The Family Of Plant Non-Specific Lipid Transfer
Protein Pan-Allergens
pdb|2B5S|A Chain A, Crystal Structure Of Peach Pru P3, The Prototypic Member
Of The Family Of Plant Non-Specific Lipid Transfer
Protein Pan-Allergens
pdb|2B5S|B Chain B, Crystal Structure Of Peach Pru P3, The Prototypic Member
Of The Family Of Plant Non-Specific Lipid Transfer
Protein Pan-Allergens
Length = 92
Score = 25.8 bits (55), Expect = 8.3, Method: Compositional matrix adjust.
Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 1/30 (3%)
Query: 38 CGDQLADFSACLPFVGGKAKSPTPTCCSNI 67
CG + + C+P+V G P P CC+ I
Sbjct: 4 CGQVSSSLAPCIPYVRGGGAVP-PACCNGI 32
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.129 0.386
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,150,602
Number of Sequences: 62578
Number of extensions: 147559
Number of successful extensions: 225
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 222
Number of HSP's gapped (non-prelim): 5
length of query: 147
length of database: 14,973,337
effective HSP length: 90
effective length of query: 57
effective length of database: 9,341,317
effective search space: 532455069
effective search space used: 532455069
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)