Citrus Sinensis ID: 039966

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----
KNSFIWLGPRPNINITDPKMIREILLKYDIFEKQVSPISKLLVSGMVVYEGKQWFKVRKIATPTFHQDKLKNMLPTIQKSCNDMLSKWKTSISKEGSSELDVWPHIQTLTADVISRTAFGSSFEEGRKIFEVLREQMNLLIQALMFAYIPGWRFVPNRLNRKLKSNHHEMGELVKGIINQREEALKLFYLAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQLKVVTKFVYSPAPLLTRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQISFLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAPTRGITVYPQHGANIILHKI
ccEEEEEccccEEEEccHHHHHHHHHccccccccccHHHHHHHccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHccccccccccccccccccccccccEEEccEEEccccEEEEcHHHccccccccccccccccccccccccccccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHccEEEEcccccccccccEEEEcccccEEEEEEc
ccEEEEEccccEEEEccHHHHHHHHHHccccccccccHHHHHHcccEccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccHHHHcEEEEEEccccHHHHHHHccccEEEccEEccccEEEEEEEEEEEcccHHccccHHHccHHHHHccccccccccccccccccHHHccccHHHHHHHHHHHHHHHHHHEEEEccccccccEEEcccEEEccccEEEEEcc
knsfiwlgprpninitdpKMIREILLKYDIFEKQVSPISKLLVSGMVVYEGKQWfkvrkiatptfhqdklknmLPTIQKSCNDMLSKWKTSIskegsseldvwphiQTLTADvisrtafgssfEEGRKIFEVLREQMNLLIQALMFAyipgwrfvpnrlnrkLKSNHHEMGELVKGIINQREEALKLFYLAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVfgnrepkfeelNQLKVVTkfvyspaplltranfkeiklgefiippgvflslpiifvhrdheywgddakkfnpdrfSEVVSKASKNQISFlsfgwgpricigQNFALLEAKLALAMILQKFTfqlsptyvhaptrgitvypqhganiilhki
knsfiwlgprpninitdpkMIREILLKYDIFEKQVSPISKLLVSGMVVYEGKQWFKVRKIATPTFHQDKLKNMLPTIQKSCNDMLSKWKTSISKegsseldvWPHIQTLTADVISRTAFGSSFEEGRKIFEVLREQMNLLIQALMFAYIPGWRFVPNRLNRKLKSNHHEMGELVKGIINQREEALKLFYLAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNRepkfeelnqlkvvTKFVYSPAPLLTRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQISFLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAPTRGITVYPQHGANIILHKI
KNSFIWLGPRPNINITDPKMIREILLKYDIFEKQVSPISKLLVSGMVVYEGKQWFKVRKIATPTFHQDKLKNMLPTIQKSCNDMLSKWKTSISKEGSSELDVWPHIQTLTADVISRTAFGSSFEEGRKIFEVLREQMNLLIQALMFAYIPGWRFVPNRLNRKLKSNHHEMGELVKGIINQREEALKLFYLAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQLKVVTKFVYSPAPLLTRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQISFLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAPTRGITVYPQHGANIILHKI
***FIWLGPRPNINITDPKMIREILLKYDIFEKQVSPISKLLVSGMVVYEGKQWFKVRKIATPTFHQDKLKNMLPTIQKSCNDMLSKWKTSI******ELDVWPHIQTLTADVISRTAFGSSFEEGRKIFEVLREQMNLLIQALMFAYIPGWRFVPNRLNRKLKSNHHEMGELVKGIINQREEALKLFYLAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQLKVVTKFVYSPAPLLTRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQISFLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAPTRGITVYPQHGANIIL***
KNSFIWLGPRPNINITDPKMIREILLKYDIFEKQVSPISKLLVSGMVVYEGKQWFKVRKIATPTFHQDKLKNMLPTIQKSCNDMLSKWKT******SSELDVWPHIQTLTADVISRTAFGSSFEEGRKIFEVLREQMNLLIQALMFAYIPGWRFVPNRLNRKLKSNHHEMGELVKGIINQREEALKLFYLAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQLKVVTKFVYSPAPLLTRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQISFLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAPTRGITVYPQHGANIILHKI
KNSFIWLGPRPNINITDPKMIREILLKYDIFEKQVSPISKLLVSGMVVYEGKQWFKVRKIATPTFHQDKLKNMLPTIQKSCNDMLSKWKTSISKEGSSELDVWPHIQTLTADVISRTAFGSSFEEGRKIFEVLREQMNLLIQALMFAYIPGWRFVPNRLNRKLKSNHHEMGELVKGIINQREEALKLFYLAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQLKVVTKFVYSPAPLLTRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQISFLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAPTRGITVYPQHGANIILHKI
KNSFIWLGPRPNINITDPKMIREILLKYDIFEKQVSPISKLLVSGMVVYEGKQWFKVRKIATPTFHQDKLKNMLPTIQKSCNDMLSKWKTSISKEGSSELDVWPHIQTLTADVISRTAFGSSFEEGRKIFEVLREQMNLLIQALMFAYIPGWRFVPNRLNRKLKSNHHEMGELVKGIINQREEALKLFYLAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQLKVVTKFVYSPAPLLTRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQISFLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAPTRGITVYPQHGANIILHKI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KNSFIWLGPRPNINITDPKMIREILLKYDIFEKQVSPISKLLVSGMVVYEGKQWFKVRKIATPTFHQDKLKNMLPTIQKSCNDMLSKWKTSISKEGSSELDVWPHIQTLTADVISRTAFGSSFEEGRKIFEVLREQMNLLIQALMFAYIPGWRFVPNRLNRKLKSNHHEMGELVKGIINQREEALKLFYLAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQLKVVTKFVYSPAPLLTRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQISFLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAPTRGITVYPQHGANIILHKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query375 2.2.26 [Sep-21-2011]
Q05047524 Secologanin synthase OS=C N/A no 1.0 0.715 0.427 1e-101
Q9SHG5519 Cytochrome P450 72C1 OS=A no no 1.0 0.722 0.405 3e-97
O48786520 Cytochrome P450 734A1 OS= no no 0.992 0.715 0.399 2e-83
B9X287542 Cytochrome P450 734A6 OS= no no 0.984 0.680 0.367 3e-73
Q6Z6D6557 Cytochrome P450 734A2 OS= no no 0.992 0.667 0.348 1e-67
Q69XM6538 Cytochrome P450 734A4 OS= no no 0.981 0.684 0.321 7e-63
Q9FF18518 Cytokinin hydroxylase OS= no no 0.981 0.710 0.330 1e-58
Q8LIF2537 Cytochrome P450 734A5 OS= no no 0.992 0.692 0.330 6e-57
Q9ZW95512 Cytokinin hydroxylase OS= no no 0.973 0.712 0.336 6e-57
Q9HCS2524 Cytochrome P450 4F12 OS=H yes no 0.893 0.639 0.298 1e-33
>sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  367 bits (943), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/426 (42%), Positives = 265/426 (62%), Gaps = 51/426 (11%)

Query: 1   KNSFIWLGPRPNINITDPKMIREILLKYDIFEKQV---SPISKLLVSGMVVYEGKQWFKV 57
           +NSF W+G  P I++ +P++I+E+L     ++K     +P+ K L++G+  +EG +W K 
Sbjct: 97  RNSFTWMGRIPRIHVMEPELIKEVLTHSSKYQKNFDVHNPLVKFLLTGVGSFEGAKWSKH 156

Query: 58  RKIATPTFHQDKLKNMLPTIQKSCNDMLSKWKTSISKEGSSELDVWPHIQTLTADVISRT 117
           R+I +P F  +KLK+MLP      +DML+KW+    K+GS E+D++P    LT+DVIS+ 
Sbjct: 157 RRIISPAFTLEKLKSMLPAFAICYHDMLTKWEKIAEKQGSHEVDIFPTFDVLTSDVISKV 216

Query: 118 AFGSSFEEGRKIFEVLREQMNLLIQALMFAYIPGWRFVPNRLNRKLKSNHHEMGELVKGI 177
           AFGS++EEG KIF +L+E M+L I  +   YIPGW ++P + N+++K  + E+ ++++ I
Sbjct: 217 AFGSTYEEGGKIFRLLKELMDLTIDCMRDVYIPGWSYLPTKRNKRMKEINKEITDMLRFI 276

Query: 178 INQREEALK------------------------------------------LFYLAGQET 195
           IN+R +ALK                                          LFY AGQET
Sbjct: 277 INKRMKALKAGEPGEDDLLGVLLESNIQEIQKQGNKKDGGMSINDVIEECKLFYFAGQET 336

Query: 196 TASLLVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQLKVVTKFVYS------PA 249
           T  LL WT +LL  HPEWQERAREEV Q FG  +P+FE LN LK V+  +Y       P 
Sbjct: 337 TGVLLTWTTILLSKHPEWQERAREEVLQAFGKNKPEFERLNHLKYVSMILYEVLRLYPPV 396

Query: 250 PLLTRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKN 309
             LT+   K+ KLG + IP G  + LP + +HR+   WG+DA +FNP RF + V+ A+KN
Sbjct: 397 IDLTKIVHKDTKLGSYTIPAGTQVMLPTVMLHREKSIWGEDAMEFNPMRFVDGVANATKN 456

Query: 310 QISFLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAPTRGITVYPQHGAN 369
            +++L F WGPR+C+GQNFALL+AKL LAMILQ+F F ++P+YVHAP   +TV PQ G++
Sbjct: 457 NVTYLPFSWGPRVCLGQNFALLQAKLGLAMILQRFKFDVAPSYVHAPFTILTVQPQFGSH 516

Query: 370 IILHKI 375
           +I  K+
Sbjct: 517 VIYKKL 522
Converts loganin into secologanin.
Catharanthus roseus (taxid: 4058)
EC: 1EC: .EC: 3EC: .EC: 3EC: .EC: 9
>sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 Back     alignment and function description
>sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 Back     alignment and function description
>sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 Back     alignment and function description
>sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 Back     alignment and function description
>sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 Back     alignment and function description
>sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 Back     alignment and function description
>sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query375
359494173457 PREDICTED: secologanin synthase-like [Vi 0.997 0.818 0.530 1e-124
225470619 515 PREDICTED: secologanin synthase [Vitis v 0.997 0.726 0.528 1e-124
296090067 550 unnamed protein product [Vitis vinifera] 0.997 0.68 0.528 1e-124
296090110456 unnamed protein product [Vitis vinifera] 1.0 0.822 0.507 1e-123
359494208 515 PREDICTED: secologanin synthase-like [Vi 1.0 0.728 0.507 1e-123
225464373 515 PREDICTED: secologanin synthase isoform 1.0 0.728 0.5 1e-123
164604828 518 cytochrome P450 [Coptis japonica var. di 0.997 0.722 0.524 1e-123
225464367 516 PREDICTED: secologanin synthase-like [Vi 0.984 0.715 0.522 1e-122
359494406 516 PREDICTED: LOW QUALITY PROTEIN: secologa 0.994 0.722 0.518 1e-121
296090098456 unnamed protein product [Vitis vinifera] 1.0 0.822 0.497 1e-121
>gi|359494173|ref|XP_002263274.2| PREDICTED: secologanin synthase-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  452 bits (1163), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 225/424 (53%), Positives = 293/424 (69%), Gaps = 50/424 (11%)

Query: 1   KNSFIWLGPRPNINITDPKMIREILLKYDIFEKQVS-PISKLLVSGMVVYEGKQWFKVRK 59
           KN F W+GP P +NI +P+++R++LLK +IF+K  S P+ KLLVSG+VV EG+QW K RK
Sbjct: 35  KNFFTWVGPSPRVNIMEPELMRDVLLKSNIFQKTPSHPLVKLLVSGLVVLEGEQWAKRRK 94

Query: 60  IATPTFHQDKLKNMLPTIQKSCNDMLSKWKTSISKEGSSELDVWPHIQTLTADVISRTAF 119
           +  P FH +KLKNMLP    SC+DML+KWK  +S +GS ELDVWP+++ LT DVISRTAF
Sbjct: 95  MINPVFHPEKLKNMLPAFHLSCSDMLNKWK-KLSVKGSCELDVWPYLENLTGDVISRTAF 153

Query: 120 GSSFEEGRKIFEVLREQMNLLIQALMFAYIPGWRFVPNRLNRKLKSNHHEMGELVKGIIN 179
           GSS+EEGR+IF++ +EQ  L I+  M  YIPGWRF P + N+++K    E+  L+ GIIN
Sbjct: 154 GSSYEEGRRIFQLQKEQTYLAIKVAMSVYIPGWRFFPTKTNKRMKQISKEVHALLGGIIN 213

Query: 180 QREEAL------------------------------------------KLFYLAGQETTA 197
           +RE+A+                                          KLFYLAGQETT+
Sbjct: 214 KREKAMEAGETANSDLLGILMESNFREIQEHQNNTKIGMSAKDVIDECKLFYLAGQETTS 273

Query: 198 SLLVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQLKVVTKF------VYSPAPL 251
            LL+WTMVLL  H +WQ RAREEV QVFGN +P+ + LN LK+VT        +Y P  +
Sbjct: 274 VLLLWTMVLLSQHTDWQARAREEVLQVFGNNKPENDGLNHLKIVTMIFHEVLRLYPPVTV 333

Query: 252 LTRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQI 311
           LTR   K+ ++G+   P GV +SLP I VH DHE WGDDAK+FNP+RF+E VSKA+KNQ+
Sbjct: 334 LTRMVSKDTQVGDMYFPAGVQVSLPTILVHHDHEIWGDDAKEFNPERFAEGVSKATKNQV 393

Query: 312 SFLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAPTRGITVYPQHGANII 371
           SFL FGWGPR+CIGQNFA++EAK ALAMILQ+F+F+LSP+Y HAP   IT+ PQ+GA++I
Sbjct: 394 SFLPFGWGPRVCIGQNFAMMEAKTALAMILQRFSFELSPSYAHAPFSLITIQPQYGAHLI 453

Query: 372 LHKI 375
           L  +
Sbjct: 454 LRGL 457

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225470619|ref|XP_002263609.1| PREDICTED: secologanin synthase [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090067|emb|CBI39886.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090110|emb|CBI39929.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494208|ref|XP_002270501.2| PREDICTED: secologanin synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225464373|ref|XP_002265455.1| PREDICTED: secologanin synthase isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|164604828|dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta] Back     alignment and taxonomy information
>gi|225464367|ref|XP_002265676.1| PREDICTED: secologanin synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494406|ref|XP_003634774.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090098|emb|CBI39917.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query375
TAIR|locus:2089621512 CYP72A14 ""cytochrome P450, fa 0.514 0.376 0.613 1.7e-107
TAIR|locus:2089521512 CYP72A15 ""cytochrome P450, fa 0.514 0.376 0.608 7.2e-107
TAIR|locus:2089596512 CYP72A13 ""cytochrome P450, fa 0.514 0.376 0.608 1.9e-106
TAIR|locus:2089561514 CYP72A10 ""cytochrome P450, fa 0.514 0.375 0.592 4e-106
TAIR|locus:2089546508 CYP72A9 ""cytochrome P450, fam 0.557 0.411 0.558 1.3e-105
TAIR|locus:2089586512 CYP72A11 ""cytochrome P450, fa 0.514 0.376 0.597 1.9e-104
TAIR|locus:2089531515 CYP72A8 ""cytochrome P450, fam 0.557 0.405 0.493 1.6e-100
TAIR|locus:2043823520 BAS1 "PHYB ACTIVATION TAGGED S 0.514 0.371 0.455 4.5e-82
UNIPROTKB|B9X287542 CYP734A6 "Cytochrome P450 734A 0.568 0.392 0.434 2e-73
UNIPROTKB|Q6Z6D6557 CYP734A2 "Cytochrome P450 734A 0.514 0.346 0.452 7.7e-68
TAIR|locus:2089621 CYP72A14 ""cytochrome P450, family 72, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 641 (230.7 bits), Expect = 1.7e-107, Sum P(2) = 1.7e-107
 Identities = 122/199 (61%), Positives = 155/199 (77%)

Query:   183 EALKLFYLAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQLKVVT 242
             E  KLFYLAGQETT+ LLVWTMVLL  H +WQ RAREEV QVFG+++P  E LNQLKV+T
Sbjct:   314 EECKLFYLAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKQPDTEGLNQLKVMT 373

Query:   243 KFVYS------PAPLLTRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNP 296
               +Y       P   LTRA  KE+KLG+  +P GV +SLP++ VHRD E WG+DA +F P
Sbjct:   374 MILYEVLRLYPPVVQLTRAIHKEMKLGDLTLPGGVQISLPVLLVHRDTELWGNDAGEFKP 433

Query:   297 DRFSEVVSKASKNQISFLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAP 356
             +RF + +SKA+KNQ+SF  F WGPRICIGQNF LLEAK+A+++ILQ+F+F+LSP+YVHAP
Sbjct:   434 ERFKDGLSKATKNQVSFFPFAWGPRICIGQNFTLLEAKMAMSLILQRFSFELSPSYVHAP 493

Query:   357 TRGITVYPQHGANIILHKI 375
                IT+YPQ GA+++LHK+
Sbjct:   494 YTIITLYPQFGAHLMLHKL 512
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0000041 "transition metal ion transport" evidence=RCA
TAIR|locus:2089521 CYP72A15 ""cytochrome P450, family 72, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089596 CYP72A13 ""cytochrome P450, family 72, subfamily A, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089561 CYP72A10 ""cytochrome P450, family 72, subfamily A, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089546 CYP72A9 ""cytochrome P450, family 72, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089586 CYP72A11 ""cytochrome P450, family 72, subfamily A, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089531 CYP72A8 ""cytochrome P450, family 72, subfamily A, polypeptide 8"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043823 BAS1 "PHYB ACTIVATION TAGGED SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B9X287 CYP734A6 "Cytochrome P450 734A6" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6Z6D6 CYP734A2 "Cytochrome P450 734A2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query375
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 1e-88
pfam00067461 pfam00067, p450, Cytochrome P450 7e-63
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-37
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 5e-32
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 6e-31
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 4e-19
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 4e-17
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 1e-16
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 3e-16
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 2e-13
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 4e-13
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 9e-13
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 2e-12
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-12
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 1e-11
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 1e-11
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 1e-10
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 1e-09
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 1e-08
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 9e-08
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 8e-07
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 6e-05
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 8e-05
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 9e-05
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 1e-04
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information 
 Score =  276 bits (707), Expect = 1e-88
 Identities = 141/419 (33%), Positives = 218/419 (52%), Gaps = 54/419 (12%)

Query: 4   FI-WLGPRPNINITDPKMIREILLKYDIFEK----QVSPISKLLVSGMVVYEGKQWFKVR 58
           FI W G  P + +T+ ++I+E+L KY+        Q       +  G+++  G  W+  R
Sbjct: 97  FIYWNGTEPRLCLTETELIKELLTKYNTVTGKSWLQQQGTKHFIGRGLLMANGADWYHQR 156

Query: 59  KIATPTFHQDKLKNMLPTIQKSCNDMLSKWKTSISKEGSSELDVWPHIQTLTADVISRTA 118
            IA P F  D+LK     + +    ML   + ++   G +E+++  ++  LTAD+ISRT 
Sbjct: 157 HIAAPAFMGDRLKGYAGHMVECTKQMLQSLQKAVE-SGQTEVEIGEYMTRLTADIISRTE 215

Query: 119 FGSSFEEGRKIFEVLREQMNLLIQALMFAYIPGWRFVPNRLNRKLKSNHHEMGELVKGII 178
           F SS+E+G++IF +L     L  QA      PG RF P++ NR++KS   E+  L+  II
Sbjct: 216 FDSSYEKGKQIFHLLTVLQRLCAQATRHLCFPGSRFFPSKYNREIKSLKGEVERLLMEII 275

Query: 179 NQREEAL---------------------------------------KLFYLAGQETTASL 199
             R + +                                       K F+ AG ETTA L
Sbjct: 276 QSRRDCVEIGRSSSYGDDLLGMLLNEMEKKRSNGFNLNLQLIMDECKTFFFAGHETTALL 335

Query: 200 LVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQLKVVTKFV------YSPAPLLT 253
           L WT++LL  +P WQ++ R EV +V G   P  + L++L ++   +      Y PA LL 
Sbjct: 336 LTWTLMLLASNPTWQDKVRAEVAEVCGGETPSVDHLSKLTLLNMVINESLRLYPPATLLP 395

Query: 254 RANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQISF 313
           R  F++IKLG+  IP G+ + +P++ +H   E WG DA +FNPDRF+    +       F
Sbjct: 396 RMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPDRFA---GRPFAPGRHF 452

Query: 314 LSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAPTRGITVYPQHGANIIL 372
           + F  GPR CIGQ FA++EAK+ LAM++ KF+F +S  Y HAP   +T+ P++G  + L
Sbjct: 453 IPFAAGPRNCIGQAFAMMEAKIILAMLISKFSFTISDNYRHAPVVVLTIKPKYGVQVCL 511

Length = 516
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 375
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
PLN02648480 allene oxide synthase 100.0
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.2e-65  Score=458.30  Aligned_cols=371  Identities=31%  Similarity=0.548  Sum_probs=290.1

Q ss_pred             CccccccCCCCeEEecCHHHHHHHHhh-hhhccc--c--ccccc-cccccceeeccCchHHHHHhhhcCCCChHHHhhhh
Q 039966            1 KNSFIWLGPRPNINITDPKMIREILLK-YDIFEK--Q--VSPIS-KLLVSGMVVYEGKQWFKVRKIATPTFHQDKLKNML   74 (375)
Q Consensus         1 ~v~~~~~g~~~~v~v~d~~~i~~il~~-~~~f~~--~--~~~~~-~~~g~~l~~~~g~~~~~~R~~~~~~~~~~~l~~~~   74 (375)
                      |++.++.|.+|+++|+|||+|++|+.+ .+.|..  +  ..... ++...+++.++|+.|+++|..++|.|++.+++.+.
T Consensus        67 ~~~G~y~~~~p~l~v~D~elik~I~ik~F~~F~~r~~~~~~d~~~~l~~~~Lf~~~g~~WK~lR~~lsP~Fts~kmk~m~  146 (499)
T KOG0158|consen   67 PVVGIYEGRQPALLVSDPELIKEILIKDFDNFYNRKRPIYGDPEDPLSALNLFFLRGERWKRLRTKLSPTFTSGKLKKMF  146 (499)
T ss_pred             CEEEEEecCCcceEecCHHHHHHHHHHhCccCcCCCCCCcCCCCCcccccCchhccCchHHHHHHhhccccchhhHHHHH
Confidence            678999999999999999999999987 777776  3  22222 34446789999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhhhcCCCcccchhHHHHHHHHHHHHHhhhcCCcchhh----hHHHHHHHHHHHHHH-----HHH
Q 039966           75 PTIQKSCNDMLSKWKTSISKEGSSELDVWPHIQTLTADVISRTAFGSSFEEGR----KIFEVLREQMNLLIQ-----ALM  145 (375)
Q Consensus        75 ~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~fG~~~~~~~----~~~~~~~~~~~~~~~-----~~~  145 (375)
                      +.+++.++++++.+.+....  +..+++.+.+.+++.|+++.++||.+.+...    ++..........+..     ...
T Consensus       147 ~t~~~~~~~l~~~l~~~~~~--~~~~~~~dl~~~yT~DVI~~~AfG~~~~s~~d~~~~F~~~~~~~~~~~~~~~~l~~~~  224 (499)
T KOG0158|consen  147 PTMEEVGDELVRHLRRKSEG--GQEGEIKDLCARYTTDVIGSCAFGLDANSLRDPKAEFRRMGRRAFFLSRGLFPLKFML  224 (499)
T ss_pred             HHHHHHHHHHHHHHHHhhcc--cCCccHHHHHHHHHHHHHhHhhcccchhhhcCchHHHHHhhHHHHHHhhccchHhHhH
Confidence            99999999999999885432  1478899999999999999999999876432    222211121111000     001


Q ss_pred             hhhcCCccc------ccchh-------hHHHHhhh----HHHHHHHHHHHHHHHH------------------HHhhhhh
Q 039966          146 FAYIPGWRF------VPNRL-------NRKLKSNH----HEMGELVKGIINQREE------------------ALKLFYL  190 (375)
Q Consensus       146 ~~~~p~~~~------~~~~~-------~~~~~~~~----~~~~~~~~~~i~~~~~------------------~~~~~~~  190 (375)
                      ...+|.+..      .+...       .....+.+    ..-.|+++-+++.+.+                  ....+++
T Consensus       225 ~~~~p~l~~~l~~~~~~~~~~~~~~~~v~~~v~~R~~~~~~r~Dfi~lll~~~~~~~~~~~~~~~lt~dei~aQafvFl~  304 (499)
T KOG0158|consen  225 IFLFPKLALPLRVKLFPEDVTDFFRKLVNSRVEQREKENIERNDFIDLLLDARASDFAKSKSHKALTDDEIAAQAFVFLL  304 (499)
T ss_pred             HHHhHHHHHhhhcccChHHHHHHHHHHHHHHHHHHHhcCCCCchHHHHHHHhhcccccccccccccCHHHHHHHHHHHHH
Confidence            111221110      00000       00000001    1122444445544432                  1177899


Q ss_pred             cchhcHHHHHHHHHHHHhhChHHHHHHHHHHHHHhCCCC-CChhhhhcchhhhhh------hccCCccccccccccceec
Q 039966          191 AGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNRE-PKFEELNQLKVVTKF------VYSPAPLLTRANFKEIKLG  263 (375)
Q Consensus       191 ag~~tt~~~l~~~l~~l~~~p~~~~~l~~Ei~~~~~~~~-~~~~~l~~l~~l~a~------l~p~~~~~~R~~~~d~~l~  263 (375)
                      ||.||||+++++++|+|++||++|+|||+||++++.+.. +++|.+.+|+||++|      +||+++.+.|.|++|++++
T Consensus       305 AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~~~~~ltyd~l~~L~YLd~Vi~ETLR~yP~~~~~~R~C~k~~~i~  384 (499)
T KOG0158|consen  305 AGFETTASTLSFALYELAKNPDVQDKLREEIDEVLEEKEGLTYDSLSKLKYLDMVIKETLRLYPPAPFLNRECTKDYEIP  384 (499)
T ss_pred             hhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhcccCCCCHHHHhCCcHHHHHHHHHHhhCCCcccccceecCceecC
Confidence            999999999999999999999999999999999976433 999999999999999      8999999999999999999


Q ss_pred             -CEEeCCCCeEEEcceecccCCCCccCCCCccCCCCCCCchhhcccCCCceeccCCCCCCchhHHHHHHHHHHHHHHHHH
Q 039966          264 -EFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQISFLSFGWGPRICIGQNFALLEAKLALAMILQ  342 (375)
Q Consensus       264 -g~~ipkG~~v~~~~~~~~~d~~~~~~~p~~F~PeR~l~~~~~~~~~~~~~~~Fg~G~~~C~G~~la~~~~~~~l~~ll~  342 (375)
                       +|.||||+.|.++.+++||||++| |||++|+||||.+++.+ ..++.+|+|||.|||.|+|+++|.+|+|++|++||+
T Consensus       385 ~~~~i~kG~~V~Ip~~alH~Dp~~~-p~Pe~F~PERF~~~~~~-~~~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~~lL~  462 (499)
T KOG0158|consen  385 GGFVIPKGTPVMIPTYALHHDPEYW-PEPEKFKPERFEEENNK-SRHPGAYLPFGVGPRNCIGMRFALMEAKLALAHLLR  462 (499)
T ss_pred             CCeEeCCCCEEEeecccccCCcccC-CCcccCCCccCCCCccc-ccCCccccCCCCCccccHHHHHHHHHHHHHHHHHHh
Confidence             999999999999999999999999 99999999999987644 457899999999999999999999999999999999


Q ss_pred             hceeeeCCCCCCCCcc---ceeeecCCCcceEEEeC
Q 039966          343 KFTFQLSPTYVHAPTR---GITVYPQHGANIILHKI  375 (375)
Q Consensus       343 ~f~~~~~~~~~~~~~~---~~~~~p~~~~~~~~~~~  375 (375)
                      +|+++..+........   +++..|++|+.+++.+|
T Consensus       463 ~f~~~~~~~t~~~~~~~~~~~~l~pk~gi~Lkl~~r  498 (499)
T KOG0158|consen  463 NFSFEVCPTTIIPLEGDPKGFTLSPKGGIWLKLEPR  498 (499)
T ss_pred             hCEEecCCcccCcccCCccceeeecCCceEEEEEeC
Confidence            9999987732222222   67899999999999886

>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query375
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 2e-30
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 3e-30
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 3e-30
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 8e-23
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 2e-22
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 2e-22
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 2e-22
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 2e-22
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 2e-22
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 2e-22
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 2e-22
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 2e-22
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 2e-22
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-22
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 2e-22
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 3e-22
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 3e-22
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-22
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-22
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 6e-22
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 6e-22
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 6e-22
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 6e-22
1fah_A471 Structure Of Cytochrome P450 Length = 471 7e-22
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 7e-22
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 8e-22
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 8e-22
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 8e-22
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 8e-22
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 8e-22
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 8e-22
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 9e-22
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 1e-21
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-21
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 1e-21
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-21
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 1e-21
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-21
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-21
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 2e-21
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 2e-21
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 4e-21
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 6e-21
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 6e-21
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 2e-18
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 2e-17
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 5e-16
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 3e-15
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 5e-15
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 1e-14
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 2e-14
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 1e-13
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-13
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-13
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-13
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 4e-13
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 5e-13
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 1e-12
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 2e-12
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 3e-12
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 3e-12
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 7e-12
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-11
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-11
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 1e-10
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 2e-10
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 2e-10
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 2e-10
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 2e-10
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 2e-10
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 3e-10
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 4e-10
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 5e-10
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 5e-10
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 5e-10
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 5e-10
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 5e-10
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 6e-10
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 7e-10
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 1e-09
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 1e-09
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 1e-09
1gwi_A411 The 1.92 A Structure Of Streptomyces Coelicolor A3( 1e-09
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-09
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 2e-09
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 2e-09
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 5e-09
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 8e-09
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 2e-08
1io8_A368 Thermophilic Cytochrome P450 (Cyp119) From Sulfolob 2e-08
1f4t_A368 Thermophilic P450: Cyp119 From Sulfolobus Solfactar 2e-08
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 4e-08
1ued_A406 Crystal Structure Of Oxyc A Cytochrome P450 Implica 2e-07
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 3e-07
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 3e-07
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 9e-07
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 1e-06
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 1e-06
2vz7_A436 Crystal Structure Of The Yc-17-Bound Pikc D50n Muta 3e-06
2whw_A436 Selective Oxidation Of Carbolide C-H Bonds By Engin 3e-06
2bvj_A436 Ligand-Free Structure Of Cytochrome P450 Pikc (Cyp1 3e-06
2vrv_A431 Structure Of Histidine Tagged Cytochrome P450 Eryk 4e-06
2jjn_A411 Structure Of Closed Cytochrome P450 Eryk Length = 4 4e-06
2z36_A413 Crystal Structure Of Cytochrome P450 Moxa From Nono 5e-06
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 6e-06
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 6e-06
3ejb_B404 Crystal Structure Of P450bioi In Complex With Tetra 7e-06
3abb_A408 Crystal Structure Of Cyp105d6 Length = 408 2e-05
3pm0_A507 Structural Characterization Of The Complex Between 2e-05
1ue8_A367 Crystal Structure Of Thermophilic Cytochrome P450 F 2e-05
2zbx_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 4e-05
2zby_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 4e-05
3cv9_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 4e-05
3cv8_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 4e-05
1z8q_A404 Ferrous Dioxygen Complex Of The A245t Cytochrome P4 5e-05
1lfk_A398 Crystal Structure Of Oxyb, A Cytochrome P450 Implic 5e-05
2wgy_A413 Crystal Structure Of The G243a Mutant Of Cyp130 Fro 8e-05
3p3o_A416 Crystal Structure Of The Cytochrome P450 Monooxygen 1e-04
3p3l_A406 Crystal Structure Of The Cytochrome P450 Monooxygen 1e-04
1z8p_A404 Ferrous Dioxygen Complex Of The A245s Cytochrome P4 1e-04
1jip_A403 P450eryf(A245s)KETOCONAZOLE Length = 403 1e-04
2wiv_A394 Cytochrome-P450 Xpla Heme Domain P21 Length = 394 1e-04
4ep6_A392 Crystal Structure Of The Xpla Heme Domain In Comple 1e-04
1egy_A403 Cytochrome P450eryf With 9-Aminophenanthrene Bound 2e-04
1cmj_A402 Crystal Structures Of Ferric-No Complexes Of Fungal 2e-04
1z8o_A404 Ferrous Dioxygen Complex Of The Wild-Type Cytochrom 2e-04
1jio_A403 P450eryf/6deb Length = 403 2e-04
2rfb_A343 Crystal Structure Of A Cytochrome P450 From The The 2e-04
1ehf_A403 Crystal Structures Of Cytochrome P450nor And Its Mu 2e-04
2uuq_A414 Crystal Structure Of Cyp130 From Mycobacterium Tube 2e-04
2wh8_A413 Interaction Of Mycobacterium Tuberculosis Cyp130 Wi 2e-04
1cl6_A402 Crystal Structures Of Ferric-No Complexes Of Fungal 3e-04
1ulw_A402 Crystal Structure Of P450nor Ser73gly/ser75gly Muta 3e-04
1ehe_A403 Crystal Structures Of Cytochrome P450nor And Its Mu 4e-04
1jfb_A404 X-Ray Structure Of Nitric Oxide Reductase (Cytochro 4e-04
1cmn_A402 Crystal Structures Of Ferric-No Complexes Of Fungal 5e-04
1ehg_A403 Crystal Structures Of Cytochrome P450nor And Its Mu 6e-04
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 8e-04
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 8e-04
1xqd_A403 Crystal Structure Of P450nor Complexed With 3- Pyri 9e-04
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure 
Iteration: 1

 Score =  129 bits (324), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 115/408 (28%), Positives = 186/408 (45%), Gaps = 82/408 (20%)
Query: 6   WLGPRPNINITDPKMIREILLK--YDIF--EKQVSPISKLLVSGMVVYEGKQWFKVRKIA 61
           + G +P + ITDP MI+ +L+K  Y +F   +   P+   + S + + E ++W ++R + 
Sbjct: 53  YDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVG-FMKSAISIAEDEEWKRLRSLL 111
Query: 62  TPTFHQDKLKNMLPTIQKSCNDMLSKWKTSISKEGSSEL-DVWPHIQTLTADVISRTAFG 120
           +PTF   KLK M+P I +  + ++   +          L DV+      + DVI+ T+FG
Sbjct: 112 SPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVF---GAYSMDVITSTSFG 168
Query: 121 ----------SSFEEGRK-----------------------IFEVL------REQMNLLI 141
                       F E  K                       I EVL      RE  N L 
Sbjct: 169 VNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLR 228
Query: 142 QALMFAYIPGWRFVPNRLNRKLKSNHHEMGELVKGIINQREEALK------------LFY 189
           +++        R   +RL    K     +  ++    ++  E+ K            +F 
Sbjct: 229 KSVK-------RMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFI 281
Query: 190 LAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNREP-------KFEELNQLKVVT 242
            AG ETT+S+L + M  L  HP+ Q++ +EE+  V  N+ P       + E L+ +   T
Sbjct: 282 FAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNET 341
Query: 243 KFVYSPAPLLTRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEV 302
             ++  A  L R   K++++    IP GV + +P   +HRD +YW  + +KF P+RFS  
Sbjct: 342 LRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYW-TEPEKFLPERFS-- 398
Query: 303 VSKASKNQIS---FLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQ 347
             K +K+ I    +  FG GPR CIG  FAL+  KLAL  +LQ F+F+
Sbjct: 399 --KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFK 444
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1GWI|A Chain A, The 1.92 A Structure Of Streptomyces Coelicolor A3(2) Cyp154c1: A New Monooxygenase That Functionalizes Macrolide Ring Systems Length = 411 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 Back     alignment and structure
>pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|1UED|A Chain A, Crystal Structure Of Oxyc A Cytochrome P450 Implicated In An Oxidative C-C Coupling Reaction During Vancomycin Biosynthesis. Length = 406 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|2VZ7|A Chain A, Crystal Structure Of The Yc-17-Bound Pikc D50n Mutant Length = 436 Back     alignment and structure
>pdb|2WHW|A Chain A, Selective Oxidation Of Carbolide C-H Bonds By Engineered Macrolide P450 Monooxygenase Length = 436 Back     alignment and structure
>pdb|2BVJ|A Chain A, Ligand-Free Structure Of Cytochrome P450 Pikc (Cyp107l1) Length = 436 Back     alignment and structure
>pdb|2VRV|A Chain A, Structure Of Histidine Tagged Cytochrome P450 Eryk In Complex With Inhibitor Clotrimazole (Clt) Length = 431 Back     alignment and structure
>pdb|2JJN|A Chain A, Structure Of Closed Cytochrome P450 Eryk Length = 411 Back     alignment and structure
>pdb|2Z36|A Chain A, Crystal Structure Of Cytochrome P450 Moxa From Nonomuraea Recticatena (Cyp105) Length = 413 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 Back     alignment and structure
>pdb|3ABB|A Chain A, Crystal Structure Of Cyp105d6 Length = 408 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 Back     alignment and structure
>pdb|2ZBX|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (Wild Type) With Imidazole Bound Length = 412 Back     alignment and structure
>pdb|2ZBY|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R84a Mutant) Length = 412 Back     alignment and structure
>pdb|3CV9|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R73aR84A MUTANT) IN COMPLEX WITH 1ALPHA,25- Dihydroxyvitamin D3 Length = 412 Back     alignment and structure
>pdb|3CV8|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R84f Mutant) Length = 412 Back     alignment and structure
>pdb|1Z8Q|A Chain A, Ferrous Dioxygen Complex Of The A245t Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1LFK|A Chain A, Crystal Structure Of Oxyb, A Cytochrome P450 Implicated In An Oxidative Phenol Coupling Reaction During Vancomycin Biosynthesis Length = 398 Back     alignment and structure
>pdb|2WGY|A Chain A, Crystal Structure Of The G243a Mutant Of Cyp130 From M. Tuberculosis Length = 413 Back     alignment and structure
>pdb|3P3O|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Ntermii) From Streptomyces Thioluteus Length = 416 Back     alignment and structure
>pdb|3P3L|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Wildtype) From Streptomyces Thioluteus Length = 406 Back     alignment and structure
>pdb|1Z8P|A Chain A, Ferrous Dioxygen Complex Of The A245s Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1JIP|A Chain A, P450eryf(A245s)KETOCONAZOLE Length = 403 Back     alignment and structure
>pdb|2WIV|A Chain A, Cytochrome-P450 Xpla Heme Domain P21 Length = 394 Back     alignment and structure
>pdb|4EP6|A Chain A, Crystal Structure Of The Xpla Heme Domain In Complex With Imidazole And Peg Length = 392 Back     alignment and structure
>pdb|1EGY|A Chain A, Cytochrome P450eryf With 9-Aminophenanthrene Bound Length = 403 Back     alignment and structure
>pdb|1CMJ|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Their Ser286 Mutants At Cryogenic Temperature Length = 402 Back     alignment and structure
>pdb|1Z8O|A Chain A, Ferrous Dioxygen Complex Of The Wild-Type Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1JIO|A Chain A, P450eryf/6deb Length = 403 Back     alignment and structure
>pdb|2RFB|A Chain A, Crystal Structure Of A Cytochrome P450 From The Thermoacidophilic Archaeon Picrophilus Torridus Length = 343 Back     alignment and structure
>pdb|1EHF|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 Back     alignment and structure
>pdb|2UUQ|A Chain A, Crystal Structure Of Cyp130 From Mycobacterium Tuberculosis In The Ligand-Free Form Length = 414 Back     alignment and structure
>pdb|2WH8|A Chain A, Interaction Of Mycobacterium Tuberculosis Cyp130 With Heterocyclic Arylamines Length = 413 Back     alignment and structure
>pdb|1CL6|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Its Ser286 Mutants At Cryogenic Temperature Length = 402 Back     alignment and structure
>pdb|1ULW|A Chain A, Crystal Structure Of P450nor Ser73gly/ser75gly Mutant Length = 402 Back     alignment and structure
>pdb|1EHE|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 Back     alignment and structure
>pdb|1JFB|A Chain A, X-Ray Structure Of Nitric Oxide Reductase (Cytochrome P450nor) In The Ferric Resting State At Atomic Resolution Length = 404 Back     alignment and structure
>pdb|1CMN|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Their Ser286 Mutants At Cryogenic Temperature Length = 402 Back     alignment and structure
>pdb|1EHG|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|1XQD|A Chain A, Crystal Structure Of P450nor Complexed With 3- Pyridinealdehyde Adenine Dinucleotide Length = 403 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query375
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-139
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-131
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 1e-126
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 1e-103
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-87
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-85
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-84
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 4e-84
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 4e-81
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-75
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 4e-68
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-67
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-62
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 5e-62
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 8e-59
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 1e-53
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 3e-52
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 8e-47
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-42
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 4e-36
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 2e-35
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 9e-35
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-34
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 5e-34
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 4e-32
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-31
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 4e-31
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 4e-31
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 9e-31
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 1e-14
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 3e-14
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 1e-13
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 3e-13
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 6e-13
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 6e-13
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 6e-13
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 1e-12
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 1e-12
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 3e-12
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 3e-12
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 5e-12
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 8e-12
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 1e-11
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 1e-11
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 2e-11
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 2e-11
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 4e-11
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 4e-11
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 6e-11
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 7e-11
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 8e-11
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 9e-11
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 1e-10
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 1e-10
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 2e-10
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 3e-10
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 4e-10
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 4e-10
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 4e-10
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 6e-10
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 8e-10
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 8e-10
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 8e-10
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 1e-09
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 1e-09
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 2e-09
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 2e-09
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 3e-09
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 3e-09
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 8e-09
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 8e-09
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 1e-08
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 1e-08
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 1e-07
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score =  403 bits (1038), Expect = e-139
 Identities = 87/422 (20%), Positives = 177/422 (41%), Gaps = 54/422 (12%)

Query: 1   KNSFIWLGPRPNINITDPKMIREIL-----LKYDIFEKQVSPI--SKLLVSGMV-VYEGK 52
               + +  + ++ +T P+ +++ L      K     + +  +   +L   G+V     +
Sbjct: 25  PVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYE 84

Query: 53  QWFKVRKIATPTFHQDKLKNMLPTIQKSCNDMLSKWKTSISKEGSSELDVWPHIQTLTAD 112
           +W K R++    F +  L +++ T  +    ++   +     +G + + +   +     D
Sbjct: 85  RWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKA--DGQTPVSMQDMLTYTAMD 142

Query: 113 VISRTAFGSSFEEGRKIFEVLREQMNLLIQALMFAYIPGWRFVPN--RLNRKLKSNHHEM 170
           ++++ AFG          + L + + L+++ +  +     +F+P   +  R+++ +   +
Sbjct: 143 ILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFL 202

Query: 171 GELVKGIINQREEALK-------------------------------LFYLAGQETTASL 199
            ++ +  + +R EALK                                F++AG ET+A+ 
Sbjct: 203 RQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANH 262

Query: 200 LVWTMVLLCIHPEWQERAREEVCQVFGN-REPKFEELNQLKVVTKFV------YSPAPLL 252
           L +T++ L   PE   R + EV +V G+ R   FE+L +L+ +++ +      Y PA   
Sbjct: 263 LAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGT 322

Query: 253 TRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQIS 312
            R   +E  +    +P    L      + R   Y+ +D   FNPDRF      A K + +
Sbjct: 323 FRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYF-EDPLTFNPDRFGP---GAPKPRFT 378

Query: 313 FLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAPTRGITVYPQHGANIIL 372
           +  F  G R CIGQ FA +E K+ +A +LQ+  F+L P          T+ P       L
Sbjct: 379 YFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTL 438

Query: 373 HK 374
             
Sbjct: 439 RP 440
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query375
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-63  Score=466.27  Aligned_cols=371  Identities=20%  Similarity=0.323  Sum_probs=294.9

Q ss_pred             CccccccCCCCeEEecCHHHHHHHHhhhhhcccc-cc-c---cccc--cccceeeccCchHHHHHhhhcCCC-ChHHHhh
Q 039966            1 KNSFIWLGPRPNINITDPKMIREILLKYDIFEKQ-VS-P---ISKL--LVSGMVVYEGKQWFKVRKIATPTF-HQDKLKN   72 (375)
Q Consensus         1 ~v~~~~~g~~~~v~v~d~~~i~~il~~~~~f~~~-~~-~---~~~~--~g~~l~~~~g~~~~~~R~~~~~~~-~~~~l~~   72 (375)
                      |+|++++|+.++|+++||+++++|+.+...|.++ .. .   ....  .+.++++.+|+.|+++|+++.+.| +.+.++.
T Consensus        63 ~i~~~~~g~~~~vvv~dp~~~~~il~~~~~~~~r~~~~~~~~~~~~~~~~~~l~~~~g~~w~~~Rr~~~~~f~~~~~~~~  142 (482)
T 3k9v_A           63 QIFRMKLGSFDSVHLGSPSLLEALYRTESAHPQRLEIKPWKAYRDHRNEAYGLMILEGQEWQRVRSAFQKKLMKPVEIMK  142 (482)
T ss_dssp             SEEEEEETTEEEEEECSHHHHHHHHHTCCSSCCCCCCHHHHHHHHHHTCCCCTTTCCHHHHHHHHHHHHHHHTCHHHHGG
T ss_pred             CEEEEccCCCCEEEEcCHHHHHHHHHhcCCCCCCCCchHHHHHHHhcCCCCCceeCCCchHHHHHHHhhHHhcChHHHHH
Confidence            6889999999999999999999999886667665 11 1   1112  356788889999999999999986 7888999


Q ss_pred             hhHHHHHHHHHHHHHHHHhhhcCCCcccchhHHHHHHHHHHHHHhhhcCCcchh-----hhHHHHHHHHHHHHHHHHHhh
Q 039966           73 MLPTIQKSCNDMLSKWKTSISKEGSSELDVWPHIQTLTADVISRTAFGSSFEEG-----RKIFEVLREQMNLLIQALMFA  147 (375)
Q Consensus        73 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~fG~~~~~~-----~~~~~~~~~~~~~~~~~~~~~  147 (375)
                      +.+.+.+.++++++.+.+...+ ++..+|+.+++..+++++++.++||.+++..     ++...........+.......
T Consensus       143 ~~~~i~~~~~~l~~~l~~~~~~-~g~~vd~~~~~~~~t~dvi~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  221 (482)
T 3k9v_A          143 LDKKINEVLADFLERMDELCDE-RGRIPDLYSELNKWSFESICLVLYEKRFGLLQKETEEEALTFITAIKTMMSTFGKMM  221 (482)
T ss_dssp             GHHHHHHHHHHHHHHHHHHCCT-TSCCTTHHHHHHHHHHHHHHHHHHSCCCCSSSTTSTTSSHHHHHHHHHHHTTGGGGS
T ss_pred             HHHHHHHHHHHHHHHHHHHHhc-CCCCCCHHHHHHHHHHHHHHHHHcccccCCCCCCcchHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999875331 3557999999999999999999999887321     111111111111111111111


Q ss_pred             hcC--CcccccchhhHHHHhhhHHHHHHHHHHHHHHHHH---------------------------HhhhhhcchhcHHH
Q 039966          148 YIP--GWRFVPNRLNRKLKSNHHEMGELVKGIINQREEA---------------------------LKLFYLAGQETTAS  198 (375)
Q Consensus       148 ~~p--~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~---------------------------~~~~~~ag~~tt~~  198 (375)
                      .+|  ...+++....++..+..+.+.+.+.+.++++.+.                           ...+++||+|||++
T Consensus       222 ~~p~~~~~~l~~~~~~~~~~~~~~~~~~~~~~i~~r~~~~~~~~~~d~l~~ll~~~~l~~~ei~~~~~~~~~AG~dTta~  301 (482)
T 3k9v_A          222 VTPVELHKRLNTKVWQAHTLAWDTIFKSVKPCIDNRLQRYSQQPGADFLCDIYQQDHLSKKELYAAVTELQLAAVETTAN  301 (482)
T ss_dssp             SSCHHHHHHHTCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCTTSCHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhhHHHHHhcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCchHHHHHHHhccCCCHHHHHHHHHHHHHhhhhhHHH
Confidence            222  1122333333334444445555555555554321                           16788999999999


Q ss_pred             HHHHHHHHHhhChHHHHHHHHHHHHHhC-CCCCChhhhhcchhhhhh------hccCCccccccccccceecCEEeCCCC
Q 039966          199 LLVWTMVLLCIHPEWQERAREEVCQVFG-NREPKFEELNQLKVVTKF------VYSPAPLLTRANFKEIKLGEFIIPPGV  271 (375)
Q Consensus       199 ~l~~~l~~l~~~p~~~~~l~~Ei~~~~~-~~~~~~~~l~~l~~l~a~------l~p~~~~~~R~~~~d~~l~g~~ipkG~  271 (375)
                      +++|++++|++||++|+|+++||+++++ ...++.+++.+|||++||      ++|+++.++|.+.+|++++||.|||||
T Consensus       302 ~l~~~l~~L~~~P~~q~kl~~Ei~~v~~~~~~~~~~~l~~lpyl~avi~E~lRl~p~~~~~~r~~~~d~~~~g~~ip~Gt  381 (482)
T 3k9v_A          302 SLMWILYNLSRNPQAQRRLLQEVQSVLPDNQTPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGEYALPKGT  381 (482)
T ss_dssp             HHHHHHHHHHTCHHHHHHHHHHHHHHSCTTCCCCGGGGGGCHHHHHHHHHHHHHSCSCCEEEEECSSCEEETTEEECTTC
T ss_pred             HHHHHHHHHHhCHHHHHHHHHHHHHHhCCCCCCCHHHHhhCHHHHHHHHHHhhcCCCCcCcccccCCceeeCCEEECCCC
Confidence            9999999999999999999999999998 467899999999999999      899999999999999999999999999


Q ss_pred             eEEEcceecccCCCCccCCCCccCCCCCCCchhhcccCCCceeccCCCCCCchhHHHHHHHHHHHHHHHHHhceeeeCCC
Q 039966          272 FLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQISFLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPT  351 (375)
Q Consensus       272 ~v~~~~~~~~~d~~~~~~~p~~F~PeR~l~~~~~~~~~~~~~~~Fg~G~~~C~G~~la~~~~~~~l~~ll~~f~~~~~~~  351 (375)
                      .|+++.+++||||++| +||++|+||||++++..  ..+..|+|||.|+|.|+|+++|++|++++++.|+++|++++.++
T Consensus       382 ~v~~~~~~~~~d~~~~-~~p~~F~PeRfl~~~~~--~~~~~~~pFg~G~r~C~G~~~A~~e~~~~la~ll~~f~~~~~~~  458 (482)
T 3k9v_A          382 VLTLNTQVLGSSEDNF-EDSHKFRPERWLQKEKK--INPFAHLPFGIGKRMCIGRRLAELQLHLALCWIIQKYDIVATDN  458 (482)
T ss_dssp             EEEEECSGGGGCTTTC-SSTTSCCGGGGTCTTSC--CCGGGCCTTCCSTTSCSCHHHHHHHHHHHHHHHHHHEEEEESCC
T ss_pred             EEEEccccccCCCccC-CCcCccCccccCCCCCC--CCCccccCCCCCCcCCccHHHHHHHHHHHHHHHHHhcEEeccCC
Confidence            9999999999999999 99999999999986432  35678999999999999999999999999999999999998877


Q ss_pred             CCCCCccceeeecCCCcceEEEeC
Q 039966          352 YVHAPTRGITVYPQHGANIILHKI  375 (375)
Q Consensus       352 ~~~~~~~~~~~~p~~~~~~~~~~~  375 (375)
                      .+......++..|+++++|+|++|
T Consensus       459 ~~~~~~~~~~~~p~~~~~~~~~~R  482 (482)
T 3k9v_A          459 EPVEMLHLGILVPSRELPIAFRPR  482 (482)
T ss_dssp             CCCCEEESSSEEESSSCCEEEEEC
T ss_pred             CCcccccceeecCCCCcceEEeeC
Confidence            655555567789999999999987
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 375
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 7e-49
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 7e-47
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 1e-41
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-39
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 8e-37
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 8e-32
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-29
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 8e-26
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 7e-25
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 2e-24
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 9e-24
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 5e-23
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 2e-20
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 8e-19
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 9e-19
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 2e-18
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 1e-17
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 5e-16
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 2e-14
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 1e-13
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 2e-13
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  169 bits (428), Expect = 7e-49
 Identities = 99/426 (23%), Positives = 182/426 (42%), Gaps = 60/426 (14%)

Query: 5   IWLGPRPNINITDPKMIREILLK--YDIF-EKQVSPISKLLVSGMVVYEGKQWFKVRKIA 61
            + G +P + ITDP MI+ +L+K  Y +F  ++       + S + + E ++W ++R + 
Sbjct: 47  FYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLL 106

Query: 62  TPTFHQDKLKNMLPTIQKSCNDMLSKWKTSISKEGSSELDVWPHIQTLTADVISRTAFGS 121
           +PTF   KLK M+P I +  + ++   +     E    + +       + DVI+ T+FG 
Sbjct: 107 SPTFTSGKLKEMVPIIAQYGDVLVRNLRRE--AETGKPVTLKDVFGAYSMDVITSTSFGV 164

Query: 122 SFEEGRKIFEVLREQMNLLIQ-----ALMFAYIPGWRFVPNRLNRKLKSNHHEMGELVKG 176
           + +      +   E    L++         +       +P      +     E+   ++ 
Sbjct: 165 NIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRK 224

Query: 177 IINQREEALK---------------------------------------LFYLAGQETTA 197
            + + +E+                                         +F  AG ETT+
Sbjct: 225 SVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTS 284

Query: 198 SLLVWTMVLLCIHPEWQERAREEVCQVFGNRE-------PKFEELNQLKVVTKFVYSPAP 250
           S+L + M  L  HP+ Q++ +EE+  V  N+         + E L+ +   T  ++  A 
Sbjct: 285 SVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAM 344

Query: 251 LLTRANFKEIKLGEFIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQ 310
            L R   K++++    IP GV + +P   +HRD +YW  + +KF P+RFS+  +K + + 
Sbjct: 345 RLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYW-TEPEKFLPERFSKK-NKDNIDP 402

Query: 311 ISFLSFGWGPRICIGQNFALLEAKLALAMILQKFTFQLSPTYVHAPT--RGITVYPQHGA 368
             +  FG GPR CIG  FAL+  KLAL  +LQ F+F+             G  + P+   
Sbjct: 403 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPV 462

Query: 369 NIILHK 374
            + +  
Sbjct: 463 VLKVES 468
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query375
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.9e-62  Score=452.93  Aligned_cols=369  Identities=26%  Similarity=0.443  Sum_probs=289.8

Q ss_pred             CccccccCCCCeEEecCHHHHHHHHhh-hh-hcccc-ccccccccccceeeccCchHHHHHhhhcCCCChHHHhhhhHHH
Q 039966            1 KNSFIWLGPRPNINITDPKMIREILLK-YD-IFEKQ-VSPISKLLVSGMVVYEGKQWFKVRKIATPTFHQDKLKNMLPTI   77 (375)
Q Consensus         1 ~v~~~~~g~~~~v~v~d~~~i~~il~~-~~-~f~~~-~~~~~~~~g~~l~~~~g~~~~~~R~~~~~~~~~~~l~~~~~~~   77 (375)
                      |+|++++|++++|+|+||+++++||.+ .. .+... ........++++++++|+.|+++|+++.+.|+.++++.+.+.+
T Consensus        43 ~i~~~~l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~~~~~~~~~i~~~~g~~~~~~R~~~~~~~~~~~l~~~~~~~  122 (472)
T d1tqna_          43 KVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPII  122 (472)
T ss_dssp             SEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCCSCCGGGGGSTTTCCHHHHHHHHHHTTGGGSHHHHHTTHHHH
T ss_pred             CEEEEEECCeeEEEECCHHHHHHHHhcCCcccccCCcccccccccCCceeccCcHHHHHhhhhcCccccchhhhcccchh
Confidence            689999999999999999999999976 32 34433 3334456678898999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhhcCCCcccchhHHHHHHHHHHHHHhhhcCCcchhhh----HHHHHHHHHH---HHHHHHHhhhcC
Q 039966           78 QKSCNDMLSKWKTSISKEGSSELDVWPHIQTLTADVISRTAFGSSFEEGRK----IFEVLREQMN---LLIQALMFAYIP  150 (375)
Q Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~fG~~~~~~~~----~~~~~~~~~~---~~~~~~~~~~~p  150 (375)
                      ++.++.+++.|.+...  .+..+|+.+.+..+++++++.++||.+++..++    ..........   ..........+|
T Consensus       123 ~~~~~~~~~~l~~~~~--~~~~~dl~~~~~~~~~~v~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  200 (472)
T d1tqna_         123 AQYGDVLVRNLRREAE--TGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFP  200 (472)
T ss_dssp             HHHHHHHHHHHHHHHH--HSSCEEHHHHHHHHHHHHHHHTSSCCCCCGGGCTTCHHHHHHTTCCCCCTTSHHHHHHHHCG
T ss_pred             hhhhhccccccccccc--ccccchhhhhhhccchhhhhheecccccccccccchhhhHHHHHHhhhhhccchhccccccc
Confidence            9999999999987654  356799999999999999999999998864322    1111111000   000011111222


Q ss_pred             CcccccchhhHHHHhhhHHHHHHHHHHHHHHHH---------------------------------------HHhhhhhc
Q 039966          151 GWRFVPNRLNRKLKSNHHEMGELVKGIINQREE---------------------------------------ALKLFYLA  191 (375)
Q Consensus       151 ~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~---------------------------------------~~~~~~~a  191 (375)
                      .+.  +....+......+.+.+++...++.+++                                       ..+.+++|
T Consensus       201 ~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ls~~ei~~~~l~l~~A  278 (472)
T d1tqna_         201 FLI--PILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFA  278 (472)
T ss_dssp             GGH--HHHHHTTCCSSCHHHHHHHHHHHHHHHTTTTTTCSCCCCCHHHHHHHHHCC----CCCCCCHHHHHHHHHHHHHH
T ss_pred             ccc--cccccccccccchhhhHHHHHHHHHhhhcccccccccccchhhhhhhcccccccccccchhhhHHHhhhhhhhhc
Confidence            221  1111111122223333333333333321                                       11678999


Q ss_pred             chhcHHHHHHHHHHHHhhChHHHHHHHHHHHHHhC-CCCCChhhhhcchhhhhh------hccCCccccccccccceecC
Q 039966          192 GQETTASLLVWTMVLLCIHPEWQERAREEVCQVFG-NREPKFEELNQLKVVTKF------VYSPAPLLTRANFKEIKLGE  264 (375)
Q Consensus       192 g~~tt~~~l~~~l~~l~~~p~~~~~l~~Ei~~~~~-~~~~~~~~l~~l~~l~a~------l~p~~~~~~R~~~~d~~l~g  264 (375)
                      |++||+++++|++++|++||++|+|+++||+++++ ....+.+.+.++||+++|      ++|+++.++|.+.+|+.++|
T Consensus       279 g~~tta~~l~~~l~~L~~~Pe~~~klr~Ei~~~~~~~~~~~~~~l~~~~~l~a~i~E~lRl~p~~~~~~r~~~~d~~~~g  358 (472)
T d1tqna_         279 GYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEING  358 (472)
T ss_dssp             HHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSTTTCCCCHHHHHHCHHHHHHHHHHHHHCCTTCCEEEECCSCEEETT
T ss_pred             ccccccccceeeccccccCccccccccceeheeccccccchHHHhhccccccceeeeccccCCcccccccccccCccccC
Confidence            99999999999999999999999999999999998 566778889999999999      89999999999999999999


Q ss_pred             EEeCCCCeEEEcceecccCCCCccCCCCccCCCCCCCchhhcccCCCceeccCCCCCCchhHHHHHHHHHHHHHHHHHhc
Q 039966          265 FIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEVVSKASKNQISFLSFGWGPRICIGQNFALLEAKLALAMILQKF  344 (375)
Q Consensus       265 ~~ipkG~~v~~~~~~~~~d~~~~~~~p~~F~PeR~l~~~~~~~~~~~~~~~Fg~G~~~C~G~~la~~~~~~~l~~ll~~f  344 (375)
                      |.||||+.|+++.+++|+||++| +||++|+||||++++.+ ...+.+|+|||+|+|.|+|+++|+++++++++.||++|
T Consensus       359 ~~ipkGt~v~~~~~~~~~d~~~~-~dp~~F~PeRfl~~~~~-~~~~~~~~~FG~G~r~C~G~~~A~~~~~~~la~ll~~f  436 (472)
T d1tqna_         359 MFIPKGVVVMIPSYALHRDPKYW-TEPEKFLPERFSKKNKD-NIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNF  436 (472)
T ss_dssp             EEECTTCEEEECHHHHHTCTTTS-SSTTSCCGGGGSTTTGG-GCCTTTSCTTCCSTTSCTTHHHHHHHHHHHHHHHHTTE
T ss_pred             ceeCCCCEEEEechhhhcCchhC-CCccccCccccCCCCcc-cCCCceecCCCCCCccChhHHHHHHHHHHHHHHHHHhC
Confidence            99999999999999999999999 89999999999987543 33577899999999999999999999999999999999


Q ss_pred             eeeeCCCCC--CCCccceeeecCCCcceEEEeC
Q 039966          345 TFQLSPTYV--HAPTRGITVYPQHGANIILHKI  375 (375)
Q Consensus       345 ~~~~~~~~~--~~~~~~~~~~p~~~~~~~~~~~  375 (375)
                      +|+++++..  .......+++|++++.|+++||
T Consensus       437 ~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~R  469 (472)
T d1tqna_         437 SFKPCKETQIPLKLSLGGLLQPEKPVVLKVESR  469 (472)
T ss_dssp             EEECCTTCCSSCCBCSSSSCCBSSCCEEEEEET
T ss_pred             EEEeCCCCCCCceeccceEEeeCCCEEEEEEEC
Confidence            999876643  2233456788999999999998
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure