BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039975
         (100 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1MG7|A Chain A, Crystal Structure Of Xol-1
 pdb|1MG7|B Chain B, Crystal Structure Of Xol-1
          Length = 417

 Score = 28.9 bits (63), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 27/49 (55%)

Query: 44  RQKKRFIIPVSFLNQPSFQELLSKAEEEFGFNHPMGGLTIPCKEKLFID 92
           RQ+    + V F +Q + ++L+++ E+  GF    GG+ +  K+  F D
Sbjct: 266 RQEDYTCLEVEFDSQVALEKLMNEHEQVEGFEVQQGGILVALKKDSFFD 314


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.135    0.388 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,653,624
Number of Sequences: 62578
Number of extensions: 90487
Number of successful extensions: 235
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 233
Number of HSP's gapped (non-prelim): 2
length of query: 100
length of database: 14,973,337
effective HSP length: 66
effective length of query: 34
effective length of database: 10,843,189
effective search space: 368668426
effective search space used: 368668426
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)