BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 040009
         (70 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3TTS|A Chain A, Crystal Structure Of Beta-Galactosidase From Bacillus
           Circulans Sp. Alkalophilus
 pdb|3TTS|B Chain B, Crystal Structure Of Beta-Galactosidase From Bacillus
           Circulans Sp. Alkalophilus
 pdb|3TTS|C Chain C, Crystal Structure Of Beta-Galactosidase From Bacillus
           Circulans Sp. Alkalophilus
 pdb|3TTS|D Chain D, Crystal Structure Of Beta-Galactosidase From Bacillus
           Circulans Sp. Alkalophilus
 pdb|3TTS|E Chain E, Crystal Structure Of Beta-Galactosidase From Bacillus
           Circulans Sp. Alkalophilus
 pdb|3TTS|F Chain F, Crystal Structure Of Beta-Galactosidase From Bacillus
           Circulans Sp. Alkalophilus
 pdb|3TTY|A Chain A, Crystal Structure Of Beta-Galactosidase From Bacillus
           Circulans Sp. Alkalophilus In Complex With Galactose
 pdb|3TTY|B Chain B, Crystal Structure Of Beta-Galactosidase From Bacillus
           Circulans Sp. Alkalophilus In Complex With Galactose
 pdb|3TTY|C Chain C, Crystal Structure Of Beta-Galactosidase From Bacillus
           Circulans Sp. Alkalophilus In Complex With Galactose
 pdb|3TTY|D Chain D, Crystal Structure Of Beta-Galactosidase From Bacillus
           Circulans Sp. Alkalophilus In Complex With Galactose
 pdb|3TTY|E Chain E, Crystal Structure Of Beta-Galactosidase From Bacillus
           Circulans Sp. Alkalophilus In Complex With Galactose
 pdb|3TTY|F Chain F, Crystal Structure Of Beta-Galactosidase From Bacillus
           Circulans Sp. Alkalophilus In Complex With Galactose
          Length = 675

 Score = 28.5 bits (62), Expect = 1.1,   Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 20/30 (66%)

Query: 27  RAIDIITRNCWPAMLTSLGFTAEEGNILRG 56
           + +D+++ + +P+M T   FTA   N++RG
Sbjct: 267 KEMDVVSWDNYPSMDTPFSFTAMAHNLMRG 296


>pdb|4F2G|A Chain A, The Crystal Structure Of Ornithine Carbamoyltransferase
           From Burkholderia Thailandensis E264
          Length = 309

 Score = 28.1 bits (61), Expect = 1.3,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 4/36 (11%)

Query: 24  DCCRAIDIITRNCWPAMLTSLGFTAEEGNILRGYCD 59
           + C+  D++T + W    TS+GF AE     R + D
Sbjct: 212 EACKGADLVTTDVW----TSMGFEAENEARKRAFAD 243


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.142    0.475 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,951,431
Number of Sequences: 62578
Number of extensions: 59397
Number of successful extensions: 143
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 142
Number of HSP's gapped (non-prelim): 2
length of query: 70
length of database: 14,973,337
effective HSP length: 40
effective length of query: 30
effective length of database: 12,470,217
effective search space: 374106510
effective search space used: 374106510
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)