BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 040024
(69 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3BU7|A Chain A, Crystal Structure And Biochemical Characterization Of
Gdosp, A Gentisate 1,2-Dioxygenase From Silicibacter
Pomeroyi
pdb|3BU7|B Chain B, Crystal Structure And Biochemical Characterization Of
Gdosp, A Gentisate 1,2-Dioxygenase From Silicibacter
Pomeroyi
Length = 394
Score = 25.8 bits (55), Expect = 6.8, Method: Composition-based stats.
Identities = 10/33 (30%), Positives = 18/33 (54%)
Query: 9 WNHPAGPKTIHFWAPTFKWGISIANIADFSNYN 41
W+ P P + W PT++ ++ A +D S Y+
Sbjct: 243 WDKPYSPLLKYSWEPTYEALLNYAKASDGSPYD 275
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.134 0.456
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,029,569
Number of Sequences: 62578
Number of extensions: 59908
Number of successful extensions: 157
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 155
Number of HSP's gapped (non-prelim): 2
length of query: 69
length of database: 14,973,337
effective HSP length: 39
effective length of query: 30
effective length of database: 12,532,795
effective search space: 375983850
effective search space used: 375983850
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)