Citrus Sinensis ID: 040062

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------69
MIAEKPSWVRHEGMQIFSIDVQPGALRFATGGGDHKVRIWNMKSVGKNFENDESTQRLLATLRDHFGSVNCVRWAKHGRYIASGSDDQVILIHEKKPGSGTTEFGSGEPPDIENWKVAMTLRGHTADVVDLNWSPDDSILASGSLDNTIHIWNMSTGICTAVLRGHSSLVKGVAWDPIGSFIASQSDDKTVIIWRTSDWSLAHRTDGHWAKSLGSTFFRRLGWSPCGHFITTTHGFQKPRHSAPVLERGEWAATFDFLGHNAPIIVVKFNHSMFRRNSASSQEVKAAPVGWTNGTSKIGGKESQPYNVIAIGSQDRTITVWTTASPRPLFVAKHFFTQSVVDLSWSPDGYSLFACSLDGTVANFHFEVKELGHRLSDAELDELKRSRYGDVRGRLANLAETPAQLLLEAASAKETTTKKVVSDVQAIQAPVKSSVNIGVTTKTSEPQTDNGKKSGGVASDGLNKVSTSGRISSPVKQREYRRPDGRKRIIPEAVGVPVQQEGVTGGAQSQLHDFPPVSSDHRKDNNGVVPADGVMREVSVRGTVGRSSDVKERSGVTARATITESLVIEKVPASAAGDGNVGVEQSGNVKASGSVAATTTTLSIRVFDKKEGEDNVPVCLEARPREHAVNDIVGMGSTCMMKETEIACTRGSQTLWSDRITGKVTVLAGNINFWAVGCEDGCLQVSKDI
cCEEEccEEECccccEEEEEEcccccEEEEECccccEEEEEcccccccccccccccccccccccccccEEEEEEcccccEEEEccccccEEEEccccccccccccccccccccccEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEccccccEEEEEccccCEEEEEccccccccccccEEEEEEcccccEEEEEccccccEEEEEEEEcccCEEEEEcccccccEEEEEEcccccEEEccccccEEEcccccccccccccccccccccEEEEECccccEEEEEcccccEEEEEcccccccEEEEEEcccccEEEEECccccEEEEEccccccccccccHHHHHHHHcccccccccEEEEEEcccccEEEcccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccEEEcccccccccccEEEEccccccccccccccccccccccEEEEEECccCEEEEECccccEEEEEEcccEEEEEEccccEEEEEcc
MIAEKPSWVRHEGMQIFSIDVQPGALRFATGGGDHKVRIWNMKSVGKNFENDESTQRLLATLRDHFGSVNCVRWAKHGRYIASGSDDQVILIHEKKPGS*********PPDIENWKVAMTLRGHTADVVDLNWSPDDSILASGSLDNTIHIWNMSTGICTAVLRGHSSLVKGVAWDPIGSFIASQSDDKTVIIWRTSDWSLAHRTDGHWAKSLGSTFFRRLGWSPCGHFITTTHGFQKPRHSAPVLERGEWAATFDFLGHNAPIIVVKFNHSMFRRNSASSQEVKAAPVGWTNGTSKIGGKESQPYNVIAIGSQDRTITVWTTASPRPLFVAKHFFTQSVVDLSWSPDGYSLFACSLDGTVANFHFEVKELGHRLSDAELDEL****YGDVRGRLANLAETPA*LL********************************************************************************KRIIPE*********************************************************************ITESLVI****************************ATTTTLSIRVFDKKEGEDNVPVCLEARPREHAVNDIVGMGSTCMMKETEIACTRGSQTLWSDRITGKVTVLAGNINFWAVGCEDGCLQVSKDI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIAEKPSWVRHEGMQIFSIDVQPGALRFATGGGDHKVRIWNMKSVGKNFENDESTQRLLATLRDHFGSVNCVRWAKHGRYIASGSDDQVILIHEKKPGSGTTEFGSGEPPDIENWKVAMTLRGHTADVVDLNWSPDDSILASGSLDNTIHIWNMSTGICTAVLRGHSSLVKGVAWDPIGSFIASQSDDKTVIIWRTSDWSLAHRTDGHWAKSLGSTFFRRLGWSPCGHFITTTHGFQKPRHSAPVLERGEWAATFDFLGHNAPIIVVKFNHSMFRRNSASSQEVKAAPVGWTNGTSKIGGKESQPYNVIAIGSQDRTITVWTTASPRPLFVAKHFFTQSVVDLSWSPDGYSLFACSLDGTVANFHFEVKELGHRLSDAELDELKRSRYGDVRGRLANLAETPAQLLLEAASAKETTTKKVVSDVQAIQAPVKSSVNIGVTTKTSEPQTDNGKKSGGVASDGLNKVSTSGRISSPVKQREYRRPDGRKRIIPEAVGVPVQQEGVTGGAQSQLHDFPPVSSDHRKDNNGVVPADGVMREVSVRGTVGRSSDVKERSGVTARATITESLVIEKVPASAAGDGNVGVEQSGNVKASGSVAATTTTLSIRVFDKKEGEDNVPVCLEARPREHAVNDIVGMGSTCMMKETEIACTRGSQTLWSDRITGKVTVLAGNINFWAVGCEDGCLQVSKDI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein HIRA Histone chaperone involved in maintining knox genes silencing throughout leaf development.probableQ652L2
Protein HIRA Histone chaperone involved in maintining knox genes silencing throughout leaf development. May be involved in heterochromatic and euchromatic gene silencing.probableQ9LXN4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VYH, chain C
Confidence level:very confident
Coverage over the Query: 58-98,116-283,297-373,387-421
View the alignment between query and template
View the model in PyMOL
Template: 3FM0, chain A
Confidence level:very confident
Coverage over the Query: 6-44,56-98,115-273,307-368
View the alignment between query and template
View the model in PyMOL
Template: 1NR0, chain A
Confidence level:very confident
Coverage over the Query: 7-98,116-374,386-423
View the alignment between query and template
View the model in PyMOL
Template: 3DW8, chain B
Confidence level:confident
Coverage over the Query: 64-97,109-273,307-416
View the alignment between query and template
View the model in PyMOL
Template: 2I32, chain E
Confidence level:probable
Coverage over the Query: 474-494
View the alignment between query and template
View the model in PyMOL