Query         040084
Match_columns 127
No_of_seqs    111 out of 579
Neff          7.5 
Searched_HMMs 46136
Date          Fri Mar 29 04:58:08 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/040084.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/040084hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02362 B3:  B3 DNA binding do  99.9 3.9E-26 8.5E-31  151.0  10.4   93   13-105     1-100 (100)
  2 PF03754 DUF313:  Domain of unk  96.9  0.0056 1.2E-07   41.8   7.1   67   12-78     23-114 (114)
  3 PF04014 Antitoxin-MazE:  Antid  87.8     2.2 4.7E-05   24.0   4.8   30   73-102    13-42  (47)
  4 PLN03148 Blue copper-like prot  82.9     1.1 2.4E-05   32.6   2.4   38   76-113    41-80  (167)
  5 PF08922 DUF1905:  Domain of un  79.6      13 0.00028   23.4   7.7   64   25-91     13-80  (80)
  6 PF02298 Cu_bind_like:  Plastoc  75.3     2.1 4.4E-05   27.4   1.6   36   76-112    14-52  (85)
  7 smart00536 AXH domain in Ataxi  68.5       5 0.00011   27.5   2.4   27   62-88     75-111 (116)
  8 TIGR01439 lp_hng_hel_AbrB loop  68.3      16 0.00035   19.4   4.5   24   73-96     13-36  (43)
  9 PF12195 End_beta_barrel:  Beta  58.0     5.6 0.00012   25.3   1.0   17   77-93     24-40  (83)
 10 PRK09798 antitoxin MazE; Provi  57.8      15 0.00032   23.5   3.0   51   24-79     12-62  (82)
 11 TIGR02609 doc_partner putative  47.5      39 0.00084   20.8   3.7   31   73-104    16-46  (74)
 12 PF08517 AXH:  Ataxin-1 and HBP  46.6     4.3 9.3E-05   27.7  -0.9   25   64-88     76-110 (115)
 13 COG2336 MazE Growth regulator   45.2      56  0.0012   21.0   4.1   38   24-61     11-48  (82)
 14 PF11976 Rad60-SLD:  Ubiquitin-  44.7      26 0.00056   20.8   2.5   47   44-93      2-48  (72)
 15 PRK11347 antitoxin ChpS; Provi  41.0      36 0.00079   21.7   2.8   30   24-53     11-40  (83)
 16 cd08313 Death_TNFR1 Death doma  40.0      10 0.00023   24.1   0.2   17   70-86     12-28  (80)
 17 cd06555 ASCH_PF0470_like ASC-1  39.8      47   0.001   22.4   3.3   24   79-102    30-54  (109)
 18 COG2002 AbrB Regulators of sta  39.8      47   0.001   21.1   3.3   37   63-102    13-50  (89)
 19 TIGR02219 phage_NlpC_fam putat  38.9      46 0.00099   22.8   3.3   30   77-106    73-103 (134)
 20 PF14326 DUF4384:  Domain of un  38.7      45 0.00098   20.7   3.0   33   81-113     3-38  (83)
 21 PF05382 Amidase_5:  Bacterioph  38.4      11 0.00023   26.8   0.1   42   68-109    61-107 (145)
 22 PF06071 YchF-GTPase_C:  Protei  37.3      20 0.00044   23.1   1.2   15   77-91     69-83  (84)
 23 KOG4146 Ubiquitin-like protein  37.2      22 0.00048   23.5   1.4   14   77-90     82-95  (101)
 24 cd08316 Death_FAS_TNFRSF6 Deat  36.7      13 0.00029   24.4   0.3   17   70-86     21-37  (97)
 25 cd08356 Glo_EDI_BRP_like_17 Th  36.1      37  0.0008   21.8   2.4   16   43-58     97-112 (113)
 26 TIGR03511 GldH_lipo gliding mo  36.0      26 0.00056   25.1   1.7   32   43-74     76-111 (156)
 27 KOG0260 RNA polymerase II, lar  35.9      58  0.0013   31.0   4.2   77   13-93    341-440 (1605)
 28 PRK09974 putative regulator Pr  33.8 1.2E+02  0.0025   20.6   4.5   28   73-100    24-51  (111)
 29 KOG1114 Tripeptidyl peptidase   33.7 1.6E+02  0.0035   27.6   6.5   91   25-120   224-316 (1304)
 30 PF02938 GAD:  GAD domain;  Int  33.4      39 0.00084   21.7   2.1   25   69-93     63-87  (95)
 31 cd08306 Death_FADD Fas-associa  33.2      11 0.00024   24.0  -0.5   21   68-88     12-32  (86)
 32 PF11320 DUF3122:  Protein of u  32.9 1.1E+02  0.0024   21.5   4.4   19   44-62     18-36  (134)
 33 cd09012 Glo_EDI_BRP_like_24 Th  32.4      57  0.0012   21.0   2.9   16   44-59    108-123 (124)
 34 PF09147 DUF1933:  Domain of un  32.2      59  0.0013   24.1   3.1   24   77-100    93-116 (201)
 35 cd04867 TGS_YchF_C TGS_YchF_C:  32.0      19 0.00041   23.2   0.4   14   78-91     70-83  (83)
 36 cd08355 Glo_EDI_BRP_like_14 Th  31.5      53  0.0011   21.0   2.6   16   43-58    105-120 (122)
 37 PF01568 Molydop_binding:  Moly  30.7 1.4E+02  0.0031   18.8   5.9   48   26-74     31-82  (110)
 38 COG1525 Micrococcal nuclease (  30.4      56  0.0012   23.5   2.8   43   80-122    48-90  (192)
 39 PF04225 OapA:  Opacity-associa  30.1      59  0.0013   20.6   2.5   33   80-112    42-74  (85)
 40 PF08916 Phe_ZIP:  Phenylalanin  29.6      32 0.00069   20.7   1.1   10   70-79      1-10  (59)
 41 cd07235 MRD Mitomycin C resist  29.5      56  0.0012   20.8   2.4   16   43-58    106-121 (122)
 42 cd07254 Glo_EDI_BRP_like_20 Th  29.3      89  0.0019   19.8   3.4   19   43-61    100-118 (120)
 43 PF01052 SpoA:  Surface present  28.7      64  0.0014   19.5   2.5   27   75-101    23-49  (77)
 44 PF12681 Glyoxalase_2:  Glyoxal  28.7      59  0.0013   20.0   2.4   15   43-57     93-107 (108)
 45 PRK06033 hypothetical protein;  28.7      61  0.0013   20.6   2.4   26   74-99     21-46  (83)
 46 COG5131 URM1 Ubiquitin-like pr  28.0      39 0.00085   22.1   1.4   24   69-92     68-92  (96)
 47 PF14109 GldH_lipo:  GldH lipop  27.9      54  0.0012   22.5   2.2   58   42-100    53-113 (131)
 48 cd07246 Glo_EDI_BRP_like_8 Thi  27.7      67  0.0014   20.2   2.5   17   42-58    104-120 (122)
 49 cd03548 Rieske_RO_Alpha_OMO_CA  27.5      34 0.00073   23.4   1.1   38   66-106     9-46  (136)
 50 PF07494 Reg_prop:  Two compone  27.5      74  0.0016   15.0   2.1   13   44-56      8-20  (24)
 51 PF02381 MraZ:  MraZ protein;    27.2      88  0.0019   18.7   2.9   42   25-78     14-55  (72)
 52 TIGR01643 YD_repeat_2x YD repe  26.9 1.1E+02  0.0023   16.0   3.6   21   42-62      5-25  (42)
 53 cd04459 Rho_CSD Rho_CSD: Rho p  26.6      70  0.0015   19.6   2.3   24   64-90     27-50  (68)
 54 PF00877 NLPC_P60:  NlpC/P60 fa  26.4      46 0.00099   21.3   1.6   32   74-106    45-76  (105)
 55 KOG3995 3-hydroxyanthranilate   26.4      39 0.00084   25.8   1.3   25   76-100    45-69  (279)
 56 COG5285 Protein involved in bi  26.2      27 0.00058   27.7   0.4   44   45-92    165-208 (299)
 57 TIGR02228 sigpep_I_arch signal  25.7      86  0.0019   22.3   3.0   16   79-94     59-74  (158)
 58 cd09011 Glo_EDI_BRP_like_23 Th  25.6      84  0.0018   20.0   2.8   16   43-58    102-117 (120)
 59 cd07262 Glo_EDI_BRP_like_19 Th  25.5      77  0.0017   20.2   2.5   15   44-58    108-122 (123)
 60 cd08357 Glo_EDI_BRP_like_18 Th  25.5      91   0.002   19.6   2.9   17   43-59    108-124 (125)
 61 cd08350 BLMT_like BLMT, a bleo  25.4      77  0.0017   20.3   2.5   16   43-58    102-117 (120)
 62 cd07267 THT_Oxygenase_N N-term  25.1   1E+02  0.0022   19.5   3.0   18   43-60     93-110 (113)
 63 cd08344 MhqB_like_N N-terminal  25.1      84  0.0018   19.8   2.6   17   43-59     92-108 (112)
 64 cd07261 Glo_EDI_BRP_like_11 Th  24.9      85  0.0018   19.6   2.7   16   43-58     98-113 (114)
 65 cd08777 Death_RIP1 Death Domai  24.7      18 0.00038   23.2  -0.7   23   68-90     12-34  (86)
 66 cd07265 2_3_CTD_N N-terminal d  24.7 1.1E+02  0.0025   19.4   3.3   18   43-60    102-119 (122)
 67 PRK03760 hypothetical protein;  24.3      81  0.0018   21.3   2.5   21   68-91     96-116 (117)
 68 PF14186 Aida_C2:  Cytoskeletal  23.9      63  0.0014   23.0   1.9   49   44-92     36-90  (147)
 69 PF02972 Phycoerythr_ab:  Phyco  23.9      37  0.0008   20.2   0.7   12   98-109     4-15  (57)
 70 cd08359 Glo_EDI_BRP_like_22 Th  23.4      89  0.0019   19.6   2.6   15   43-57    103-117 (119)
 71 cd02786 MopB_CT_3 The MopB_CT_  23.1 2.1E+02  0.0047   18.3   5.6   47   25-72     31-81  (116)
 72 cd06530 S26_SPase_I The S26 Ty  22.8   1E+02  0.0023   18.6   2.7   16   79-94     30-45  (85)
 73 TIGR02480 fliN flagellar motor  22.7      86  0.0019   19.3   2.2   22   75-96     23-44  (77)
 74 COG3400 Uncharacterized protei  22.3 2.4E+02  0.0051   23.5   5.1   44   40-89    149-205 (471)
 75 PRK00809 hypothetical protein;  21.9 1.5E+02  0.0033   20.7   3.6   26   66-93     22-47  (144)
 76 PF14191 YodL:  YodL-like        21.8      88  0.0019   20.8   2.2   34   65-98     49-89  (103)
 77 cd08315 Death_TRAILR_DR4_DR5 D  21.8      32 0.00069   22.4   0.1   17   70-86     20-36  (96)
 78 PF06052 3-HAO:  3-hydroxyanthr  21.7      64  0.0014   23.1   1.6   25   76-100    45-69  (151)
 79 cd08354 Glo_EDI_BRP_like_13 Th  21.5   1E+02  0.0022   19.3   2.5   17   42-58    104-120 (122)
 80 COG3607 Predicted lactoylgluta  21.2 1.1E+02  0.0023   21.5   2.6   17   44-60    111-127 (133)
 81 PF03221 HTH_Tnp_Tc5:  Tc5 tran  20.8      58  0.0013   18.7   1.1   20   64-83     44-64  (66)
 82 PRK06724 hypothetical protein;  20.8 1.3E+02  0.0028   20.0   3.0   17   43-59    106-122 (128)
 83 cd07252 BphC1-RGP6_N_like N-te  20.8 1.3E+02  0.0029   19.1   3.0   17   43-59    100-116 (120)
 84 PF11604 CusF_Ec:  Copper bindi  20.7 1.8E+02   0.004   17.5   3.4   24   78-101    40-65  (70)
 85 cd00175 SNc Staphylococcal nuc  20.6 1.9E+02   0.004   18.9   3.7   33   81-113     2-34  (129)
 86 cd07251 Glo_EDI_BRP_like_10 Th  20.5 1.3E+02  0.0029   18.7   2.9   17   43-59    104-120 (121)
 87 cd08361 PpCmtC_N N-terminal do  20.3 1.4E+02   0.003   19.4   3.0   17   44-60    103-119 (124)
 88 PF02643 DUF192:  Uncharacteriz  20.3      76  0.0017   20.9   1.7   20   68-90     88-107 (108)
 89 PRK08433 flagellar motor switc  20.1 1.1E+02  0.0023   20.7   2.4   27   74-100    46-72  (111)
 90 cd07247 SgaA_N_like N-terminal  20.1 1.2E+02  0.0025   18.9   2.5   15   43-57     98-112 (114)

No 1  
>PF02362 B3:  B3 DNA binding domain;  InterPro: IPR003340 Two DNA binding proteins, RAV1 and RAV2 from Arabidopsis thaliana contain two distinct amino acid sequence domains found only in higher plant species. The N-terminal regions of RAV1 and RAV2 are homologous to the AP2 DNA-binding domain (see IPR001471 from INTERPRO) present in a family of transcription factors, while the C-terminal region exhibits homology to the highly conserved C-terminal domain, designated B3, of VP1/ABI3 transcription factors []. The AP2 and B3-like domains of RAV1 bind autonomously to the CAACA and CACCTG motifs, respectively, and together achieve a high affinity and specificity of binding. It has been suggested that the AP2 and B3-like domains of RAV1 are connected by a highly flexible structure enabling the two domains to bind to the CAACA and CACCTG motifs in various spacings and orientations [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1WID_A 1YEL_A.
Probab=99.94  E-value=3.9e-26  Score=150.96  Aligned_cols=93  Identities=30%  Similarity=0.592  Sum_probs=70.1

Q ss_pred             EEEeccCCccC-CCceeccHHHHHhcccC--CCceEEEEcCCCCEEEEEEE--EeCCEEEecccHHHHHhHhCCCCCCEE
Q 040084           13 FVKAVLPSTLR-DQKPRIPNKIVRKFSHE--LSDVAHITIPNGYVWQVKLK--KEGRKVWFDDGWQDFVEAYSTFVGSLV   87 (127)
Q Consensus        13 F~k~i~~~~~~-~~~L~IP~~F~~~~~~~--~~~~v~L~~~~G~~W~V~l~--~~~~~~~~~~GW~~Fv~~~~L~~GD~l   87 (127)
                      |+|+|++++.. .+.|.||..|++.|+..  .+..++|++++|+.|+|++.  +..++++|++||++||++|+|++||+|
T Consensus         1 F~K~l~~s~~~~~~~l~iP~~f~~~~~~~~~~~~~v~l~~~~g~~W~v~~~~~~~~~~~~l~~GW~~Fv~~n~L~~GD~~   80 (100)
T PF02362_consen    1 FFKVLKPSDVSSSCRLIIPKEFAKKHGGNKRKSREVTLKDPDGRSWPVKLKYRKNSGRYYLTGGWKKFVRDNGLKEGDVC   80 (100)
T ss_dssp             EEEE--TTCCCCTT-EEE-HHHHTTTS--SS--CEEEEEETTTEEEEEEEEEECCTTEEEEETTHHHHHHHCT--TT-EE
T ss_pred             CEEEEEccCcCCCCEEEeCHHHHHHhCCCcCCCeEEEEEeCCCCEEEEEEEEEccCCeEEECCCHHHHHHHcCCCCCCEE
Confidence            89999887654 47899999999999754  57799999999999999995  456789999999999999999999999


Q ss_pred             EEEEecCcEE--EEEEECCC
Q 040084           88 LFEYESNSTF--QAHIYDET  105 (127)
Q Consensus        88 vF~~~~~~~F--~V~If~~~  105 (127)
                      +|++++++.|  .|+||+++
T Consensus        81 ~F~~~~~~~~~~~v~i~~~~  100 (100)
T PF02362_consen   81 VFELIGNSNFTLKVHIFRKS  100 (100)
T ss_dssp             EEEE-SSSCE-EEEEEE---
T ss_pred             EEEEecCCCceEEEEEEECc
Confidence            9999987665  99999864


No 2  
>PF03754 DUF313:  Domain of unknown function (DUF313) ;  InterPro: IPR005508 This is a family of proteins from Arabidopsis thaliana (Mouse-ear cress) with uncharacterised function.
Probab=96.94  E-value=0.0056  Score=41.78  Aligned_cols=67  Identities=18%  Similarity=0.346  Sum_probs=48.8

Q ss_pred             eEEEeccCCccC--CCceeccHHHHHh--c----------------ccCCCceEEEEcCCCCEEEEEEEEeCC-----EE
Q 040084           12 RFVKAVLPSTLR--DQKPRIPNKIVRK--F----------------SHELSDVAHITIPNGYVWQVKLKKEGR-----KV   66 (127)
Q Consensus        12 ~F~k~i~~~~~~--~~~L~IP~~F~~~--~----------------~~~~~~~v~L~~~~G~~W~V~l~~~~~-----~~   66 (127)
                      -+.|.|..+++.  ..+|.||..=+..  +                .....-.|+|.+|+++.|.+.+++-.-     .+
T Consensus        23 i~~K~L~~tDv~~~qsRLsmP~~qi~~~dFLt~eE~~~i~~~~~~~~~~~Gv~V~lvdp~~~~~~m~lkkW~mg~~~~~Y  102 (114)
T PF03754_consen   23 IIEKTLFKTDVDPHQSRLSMPFNQIIDNDFLTEEEKRIIKEEKKNNDKKKGVEVILVDPSLRKWTMRLKKWNMGNGTSNY  102 (114)
T ss_pred             EEeeeecccCCCCCCceeeccHHHhcccccCCHHHHHHHHHhhccCcccCCceEEEECCcCcEEEEEEEEecccCCceEE
Confidence            455678888775  3778888664411  1                123356899999999999999998532     67


Q ss_pred             EecccHHHHHhH
Q 040084           67 WFDDGWQDFVEA   78 (127)
Q Consensus        67 ~~~~GW~~Fv~~   78 (127)
                      .|..||.++|++
T Consensus       103 vL~~gWn~VV~~  114 (114)
T PF03754_consen  103 VLNSGWNKVVED  114 (114)
T ss_pred             EEEcChHhhccC
Confidence            899999999864


No 3  
>PF04014 Antitoxin-MazE:  Antidote-toxin recognition MazE;  InterPro: IPR007159 This domain is found in AbrB from Bacillus subtilis. The product of the abrB gene is an ambiactive repressor and activator of the transcription of genes expressed during the transition state between vegetative growth and the onset of stationary phase and sporulation []. AbrB is thought to interact directly with the transcription initiation regions of genes under its control []. AbrB contains a helix-turn-helix structure, but this domain ends before the helix-turn-helix begins []. The product of the B. subtilis gene spoVT is another member of this family and is also a transcriptional regulator []. DNA-binding activity in this AbrB homologue requires hexamerisation []. Another family member has been isolated from the Sulfolobus solfataricus and has been identified as a homologue of bacterial repressor-like proteins. The Escherichia coli family member SohA or Prl1F appears to be bifunctional and is able to regulate its own expression as well as relieve the export block imposed by high-level synthesis of beta-galactosidase hybrid proteins [].; PDB: 2L66_A 2GLW_A 3TND_D 2W1T_B 2RO5_B 2FY9_A 2RO3_B 1UB4_C 3ZVK_G 1YFB_B ....
Probab=87.84  E-value=2.2  Score=24.00  Aligned_cols=30  Identities=17%  Similarity=0.126  Sum_probs=24.6

Q ss_pred             HHHHhHhCCCCCCEEEEEEecCcEEEEEEE
Q 040084           73 QDFVEAYSTFVGSLVLFEYESNSTFQAHIY  102 (127)
Q Consensus        73 ~~Fv~~~~L~~GD~lvF~~~~~~~F~V~If  102 (127)
                      ++++...+|+.||.+.+...++....+.-+
T Consensus        13 k~~~~~l~l~~Gd~v~i~~~~~g~i~i~p~   42 (47)
T PF04014_consen   13 KEIREKLGLKPGDEVEIEVEGDGKIVIRPV   42 (47)
T ss_dssp             HHHHHHTTSSTTTEEEEEEETTSEEEEEES
T ss_pred             HHHHHHcCCCCCCEEEEEEeCCCEEEEEEC
Confidence            578899999999999999999875555433


No 4  
>PLN03148 Blue copper-like protein; Provisional
Probab=82.91  E-value=1.1  Score=32.57  Aligned_cols=38  Identities=18%  Similarity=0.437  Sum_probs=26.4

Q ss_pred             HhHhCCCCCCEEEEEEecC--cEEEEEEECCCCeEEecCC
Q 040084           76 VEAYSTFVGSLVLFEYESN--STFQAHIYDETACEINYPS  113 (127)
Q Consensus        76 v~~~~L~~GD~lvF~~~~~--~~F~V~If~~~~ce~~~~~  113 (127)
                      +..+....||.|+|.|..+  ++.+|.==+-+.|...-|.
T Consensus        41 A~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~~~pi   80 (167)
T PLN03148         41 ANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEGAA   80 (167)
T ss_pred             hcCCCCccCCEEEEEecCCCceEEEEChHHcCcccCCCCc
Confidence            5678889999999999875  5666643333567654443


No 5  
>PF08922 DUF1905:  Domain of unknown function (DUF1905);  InterPro: IPR015018 This family consist of hypothetical bacterial proteins. ; PDB: 2D9R_A.
Probab=79.56  E-value=13  Score=23.41  Aligned_cols=64  Identities=14%  Similarity=0.111  Sum_probs=39.2

Q ss_pred             CceeccHHHHHhcccC--CCceEEEEcCCCCEEEEEEEEe-CCEEEe-cccHHHHHhHhCCCCCCEEEEEE
Q 040084           25 QKPRIPNKIVRKFSHE--LSDVAHITIPNGYVWQVKLKKE-GRKVWF-DDGWQDFVEAYSTFVGSLVLFEY   91 (127)
Q Consensus        25 ~~L~IP~~F~~~~~~~--~~~~v~L~~~~G~~W~V~l~~~-~~~~~~-~~GW~~Fv~~~~L~~GD~lvF~~   91 (127)
                      ..+.||..-++.+...  -+-.|..+- +|..|+-.+... ++.++| -+  ++..+.-++..||.+.+++
T Consensus        13 ~fv~vP~~v~~~l~~~~~g~v~V~~tI-~g~~~~~sl~p~g~G~~~Lpv~--~~vRk~~g~~~Gd~V~v~l   80 (80)
T PF08922_consen   13 TFVEVPFDVAEELGEGGWGRVPVRGTI-DGHPWRTSLFPMGNGGYILPVK--AAVRKAIGKEAGDTVEVTL   80 (80)
T ss_dssp             EEEE--S-HHHHH--S--S-EEEEEEE-TTEEEEEEEEESSTT-EEEEE---HHHHHHHT--TTSEEEEEE
T ss_pred             EEEEeCHHHHHHhccccCCceEEEEEE-CCEEEEEEEEECCCCCEEEEEc--HHHHHHcCCCCCCEEEEEC
Confidence            5678999988887766  334444443 678999988773 344444 33  7899999999999998764


No 6  
>PF02298 Cu_bind_like:  Plastocyanin-like domain;  InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ]. The most well known members of this class of proteins are the plant chloroplastic plastocyanins, which exchange electrons with cytochrome c6, and the distantly related bacterial azurins, which exchange electrons with cytochrome c551. This family of proteins also includes amicyanin from bacteria such as Methylobacterium extorquens or Paracoccus versutus (Thiobacillus versutus) that can grow on methylamine; auracyanins A and B from Chloroflexus aurantiacus []; blue copper protein from Alcaligenes faecalis; cupredoxin (CPC) from Cucumis sativus (Cucumber) peelings []; cusacyanin (basic blue protein; plantacyanin, CBP) from cucumber; halocyanin from Natronomonas pharaonis (Natronobacterium pharaonis) [], a membrane associated copper-binding protein; pseudoazurin from Pseudomonas; rusticyanin from Thiobacillus ferrooxidans []; stellacyanin from Rhus vernicifera (Japanese lacquer tree); umecyanin from the roots of Armoracia rusticana (Horseradish); and allergen Ra3 from ragweed. Although there is an appreciable amount of divergence in the sequences of all these proteins, the copper ligand sites are conserved. This domain is found in a variety of plant cyanins and pollern allergen. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Amb a 3.; GO: 0005507 copper ion binding, 0009055 electron carrier activity; PDB: 1JER_A 1WS7_A 1WS8_D 1F56_B 1X9R_B 1X9U_A 2CBP_A.
Probab=75.30  E-value=2.1  Score=27.41  Aligned_cols=36  Identities=22%  Similarity=0.479  Sum_probs=19.9

Q ss_pred             HhHhCCCCCCEEEEEEecC--cEEEEEEECC-CCeEEecC
Q 040084           76 VEAYSTFVGSLVLFEYESN--STFQAHIYDE-TACEINYP  112 (127)
Q Consensus        76 v~~~~L~~GD~lvF~~~~~--~~F~V~If~~-~~ce~~~~  112 (127)
                      +....+..||.|+|.+...  ++++|. -.. +.|...-|
T Consensus        14 a~~~~F~vGD~LvF~y~~~~h~V~~V~-~~~y~~C~~~~~   52 (85)
T PF02298_consen   14 ASGKTFRVGDTLVFNYDSGQHSVVEVS-KADYDSCNSSNP   52 (85)
T ss_dssp             HCTS-BETTEEEEEE--TTTB-EEEES-HHHHHHT--STT
T ss_pred             hcCCcEeCCCEEEEEecCCCCeEEecC-hhhCccCCCCCc
Confidence            4566788999999999974  566665 211 45655444


No 7  
>smart00536 AXH domain in Ataxins and HMG containing proteins. unknown function
Probab=68.53  E-value=5  Score=27.47  Aligned_cols=27  Identities=22%  Similarity=0.304  Sum_probs=19.6

Q ss_pred             eCCEEEecccHHHHHh----------HhCCCCCCEEE
Q 040084           62 EGRKVWFDDGWQDFVE----------AYSTFVGSLVL   88 (127)
Q Consensus        62 ~~~~~~~~~GW~~Fv~----------~~~L~~GD~lv   88 (127)
                      ...-++..+||..|.-          -+.|++||+|+
T Consensus        75 eHPfFV~gqGWsSc~P~lT~~~ygL~C~~L~vGDVCl  111 (116)
T smart00536       75 EHPFFVKGKGWSSCYPSLTVQLYGLPCCELQVGDVCL  111 (116)
T ss_pred             CCCeEEcCccccccChhhhhhhcCCcceecccCCEEe
Confidence            3456677999988753          24578899986


No 8  
>TIGR01439 lp_hng_hel_AbrB looped-hinge helix DNA binding domain, AbrB family. This DNA-binding domain family includes AbrB, a transition state regulator in Bacillus subtilis, whose DNA-binding domain structure in solution was determined by NMR. The domain binds DNA as a dimer in what is termed a looped-hinge helix fold. Some members of the family have two copies of the domain in tandem. The domain is found usually at the N-terminus of a small protein. This model excludes members of family TIGR02609.
Probab=68.26  E-value=16  Score=19.41  Aligned_cols=24  Identities=8%  Similarity=0.011  Sum_probs=19.4

Q ss_pred             HHHHhHhCCCCCCEEEEEEecCcE
Q 040084           73 QDFVEAYSTFVGSLVLFEYESNST   96 (127)
Q Consensus        73 ~~Fv~~~~L~~GD~lvF~~~~~~~   96 (127)
                      ++|.+..+++.||.+++....+..
T Consensus        13 ~~~r~~l~~~~gd~~~i~~~~~~~   36 (43)
T TIGR01439        13 KEIREKLGLKEGDRLEVIRVEDGE   36 (43)
T ss_pred             HHHHHHcCcCCCCEEEEEEeCCCE
Confidence            578999999999999998654443


No 9  
>PF12195 End_beta_barrel:  Beta barrel domain of bacteriophage endosialidase;  InterPro: IPR024427 This entry represents the beta barrel domain of endosialidases which is nested in a beta propeller domain. This beta barrel domain is approximately 80 amino acids in length and represents one of the two sialic acid binding sites of the enzyme [].; PDB: 1V0E_B 1V0F_E 3JU4_A 3GVL_A 3GVK_B 3GVJ_A.
Probab=58.02  E-value=5.6  Score=25.28  Aligned_cols=17  Identities=29%  Similarity=0.462  Sum_probs=9.1

Q ss_pred             hHhCCCCCCEEEEEEec
Q 040084           77 EAYSTFVGSLVLFEYES   93 (127)
Q Consensus        77 ~~~~L~~GD~lvF~~~~   93 (127)
                      .+|+|..||.+.|.-.+
T Consensus        24 ~~HGl~vGD~VnFsnsa   40 (83)
T PF12195_consen   24 TDHGLFVGDFVNFSNSA   40 (83)
T ss_dssp             TT----TT-EEEEES-S
T ss_pred             ccCceeecceEEEeccc
Confidence            57999999999997654


No 10 
>PRK09798 antitoxin MazE; Provisional
Probab=57.77  E-value=15  Score=23.45  Aligned_cols=51  Identities=14%  Similarity=0.270  Sum_probs=32.5

Q ss_pred             CCceeccHHHHHhcccCCCceEEEEcCCCCEEEEEEEEeCCEEEecccHHHHHhHh
Q 040084           24 DQKPRIPNKIVRKFSHELSDVAHITIPNGYVWQVKLKKEGRKVWFDDGWQDFVEAY   79 (127)
Q Consensus        24 ~~~L~IP~~F~~~~~~~~~~~v~L~~~~G~~W~V~l~~~~~~~~~~~GW~~Fv~~~   79 (127)
                      +.-++||+.|++.++-.....+.+...+|+-   .++......  ..+|.+....+
T Consensus        12 S~~vRIPk~~l~~l~l~~g~~vei~v~~~~i---iI~p~~~~~--r~~l~eLla~~   62 (82)
T PRK09798         12 SPAVRIPATLMQALNLNIDDEVKIDLVDGKL---IIEPVRKEP--VFTLAELVNDI   62 (82)
T ss_pred             cceEEcCHHHHHHcCCCCCCEEEEEEECCEE---EEEECCCCC--CCCHHHHHhcC
Confidence            3778999999999888777887777655542   222211110  23688876654


No 11 
>TIGR02609 doc_partner putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids.
Probab=47.48  E-value=39  Score=20.84  Aligned_cols=31  Identities=16%  Similarity=0.334  Sum_probs=23.6

Q ss_pred             HHHHhHhCCCCCCEEEEEEecCcEEEEEEECC
Q 040084           73 QDFVEAYSTFVGSLVLFEYESNSTFQAHIYDE  104 (127)
Q Consensus        73 ~~Fv~~~~L~~GD~lvF~~~~~~~F~V~If~~  104 (127)
                      ++++...+|..||.+.+...++. +.+...++
T Consensus        16 k~i~~~lgl~~Gd~v~v~~~~~~-iii~~~~~   46 (74)
T TIGR02609        16 KEVLESLGLKEGDTLYVDEEEGG-LKLKRFDE   46 (74)
T ss_pred             HHHHHHcCcCCCCEEEEEEECCE-EEEEECCC
Confidence            67899999999999988777653 55555544


No 12 
>PF08517 AXH:  Ataxin-1 and HBP1 module (AXH);  InterPro: IPR013723 AXH is a protein-protein and RNA binding motif found in Ataxin-1 (ATX1)[]. ATX1 is responsible for the autosomal-dominant neurodegenerative disorder Spinocerebellar ataxia type-1 (SCA1) in humans. The AXH module has also been identified in the apparently unrelated transcription factor HBP1 which is thought to be involved in the architectural regulation of chromatin and in specific gene expression []. ; GO: 0005488 binding; PDB: 1OA8_C 3QVE_C 1V06_A.
Probab=46.58  E-value=4.3  Score=27.72  Aligned_cols=25  Identities=20%  Similarity=0.274  Sum_probs=14.4

Q ss_pred             CEEEecccHHHHH-----hH-----hCCCCCCEEE
Q 040084           64 RKVWFDDGWQDFV-----EA-----YSTFVGSLVL   88 (127)
Q Consensus        64 ~~~~~~~GW~~Fv-----~~-----~~L~~GD~lv   88 (127)
                      .-++..+||..|.     .-     +.|++||+|+
T Consensus        76 PFFV~gkGWsS~~P~~T~~~ygL~C~~L~vGDvCl  110 (115)
T PF08517_consen   76 PFFVKGKGWSSCNPSLTVQLYGLPCRQLQVGDVCL  110 (115)
T ss_dssp             EEEETTTEEEESSHHHHHHHHTS--EE--TT-EEE
T ss_pred             ceEEeCCcccccCcchhceecCCcccccccCCEEe
Confidence            3455699996553     33     4567899986


No 13 
>COG2336 MazE Growth regulator [Signal transduction mechanisms]
Probab=45.23  E-value=56  Score=20.98  Aligned_cols=38  Identities=13%  Similarity=0.323  Sum_probs=30.8

Q ss_pred             CCceeccHHHHHhcccCCCceEEEEcCCCCEEEEEEEE
Q 040084           24 DQKPRIPNKIVRKFSHELSDVAHITIPNGYVWQVKLKK   61 (127)
Q Consensus        24 ~~~L~IP~~F~~~~~~~~~~~v~L~~~~G~~W~V~l~~   61 (127)
                      +-.++||...++..+-..+..++++..++..--+.-++
T Consensus        11 S~avrIP~~l~kql~l~~g~~v~v~v~n~~~i~~~p~r   48 (82)
T COG2336          11 SAAVRIPAALLKQLNLTIGDEVEVEVGNDQSILIRPVR   48 (82)
T ss_pred             cceeeccHHHHHHhCCCcCceEEEEEcCCcEEEecccc
Confidence            36789999999999888899999998777666665554


No 14 
>PF11976 Rad60-SLD:  Ubiquitin-2 like Rad60 SUMO-like;  InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins. SUMOs are small proteins that are covalently attached to lysines as post-translational modifications and are used to control multiple cellular process including signal transduction, nuclear transport and DNA replication and repair []. Unlike ubiquitin, they are not involved in protein degradation.  This entry also contains the C-terminal Rad60 DNA repair protein SUMO-like domain.; PDB: 3RD2_A 2JXX_A 3RCZ_A 3GOE_A 3A4S_D 3A4R_B 2IO1_D 1U4A_A 2K1F_A 1WZ0_A ....
Probab=44.67  E-value=26  Score=20.82  Aligned_cols=47  Identities=9%  Similarity=0.091  Sum_probs=33.7

Q ss_pred             eEEEEcCCCCEEEEEEEEeCCEEEecccHHHHHhHhCCCCCCEEEEEEec
Q 040084           44 VAHITIPNGYVWQVKLKKEGRKVWFDDGWQDFVEAYSTFVGSLVLFEYES   93 (127)
Q Consensus        44 ~v~L~~~~G~~W~V~l~~~~~~~~~~~GW~~Fv~~~~L~~GD~lvF~~~~   93 (127)
                      +++|++.+|+.-.+.+...   .-+..=...|++..++..-..+.|.++|
T Consensus         2 ~i~v~~~~~~~~~~~v~~~---~~~~~l~~~~~~~~~i~~~~~~~l~fdG   48 (72)
T PF11976_consen    2 TIKVRSQDGKEIKFKVKPT---TTVSKLIEKYCEKKGIPPEESIRLIFDG   48 (72)
T ss_dssp             EEEEEETTSEEEEEEEETT---SCCHHHHHHHHHHHTTTT-TTEEEEETT
T ss_pred             EEEEEeCCCCEEEEEECCC---CcHHHHHHHHHHhhCCCccceEEEEECC
Confidence            5788998888666666432   2367777999999999995666677766


No 15 
>PRK11347 antitoxin ChpS; Provisional
Probab=41.00  E-value=36  Score=21.66  Aligned_cols=30  Identities=13%  Similarity=0.258  Sum_probs=24.3

Q ss_pred             CCceeccHHHHHhcccCCCceEEEEcCCCC
Q 040084           24 DQKPRIPNKIVRKFSHELSDVAHITIPNGY   53 (127)
Q Consensus        24 ~~~L~IP~~F~~~~~~~~~~~v~L~~~~G~   53 (127)
                      +.-++||+.+++.++-....++.|...+|.
T Consensus        11 S~~vriPk~il~~l~l~~G~~v~i~v~~~~   40 (83)
T PRK11347         11 SAGMVIPNIVMKELNLQPGQSVEAQVSNNQ   40 (83)
T ss_pred             ceeEEeCHHHHHHcCCCCCCEEEEEEECCE
Confidence            377899999999998888888888765553


No 16 
>cd08313 Death_TNFR1 Death domain of Tumor Necrosis Factor Receptor 1. Death Domain (DD) found in tumor necrosis factor receptor-1 (TNFR-1). TNFR-1 has many names including TNFRSF1A, CD120a, p55, p60, and TNFR60. It activates two major intracellular signaling pathways that lead to the activation of the transcription factor NF-kB and the induction of cell death. Upon binding of its ligand TNF, TNFR-1 trimerizes which leads to the recruitment of an adaptor protein named TNFR-associated death domain protein (TRADD) through a DD/DD interaction. Mutations in the TNFRSF1A gene causes TNFR-associated periodic syndrome (TRAPS), a rare disorder characterized recurrent fever, myalgia, abdominal pain, conjunctivitis and skin eruptions. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation a
Probab=40.00  E-value=10  Score=24.06  Aligned_cols=17  Identities=18%  Similarity=0.474  Sum_probs=14.4

Q ss_pred             ccHHHHHhHhCCCCCCE
Q 040084           70 DGWQDFVEAYSTFVGSL   86 (127)
Q Consensus        70 ~GW~~Fv~~~~L~~GD~   86 (127)
                      .-|++|++..+|.++++
T Consensus        12 ~~wk~~~R~LGlse~~I   28 (80)
T cd08313          12 RRWKEFVRRLGLSDNEI   28 (80)
T ss_pred             HHHHHHHHHcCCCHHHH
Confidence            56999999999998753


No 17 
>cd06555 ASCH_PF0470_like ASC-1 homology domain, subfamily similar to Pyrococcus furiosus Pf0470. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation.
Probab=39.80  E-value=47  Score=22.36  Aligned_cols=24  Identities=17%  Similarity=0.232  Sum_probs=16.0

Q ss_pred             hCCCCCCEEEEEEec-CcEEEEEEE
Q 040084           79 YSTFVGSLVLFEYES-NSTFQAHIY  102 (127)
Q Consensus        79 ~~L~~GD~lvF~~~~-~~~F~V~If  102 (127)
                      -.++.||.|+|.-.. +..+.|.|-
T Consensus        30 ~~ikvGD~I~f~~~~~~~~l~v~V~   54 (109)
T cd06555          30 QQIKVGDKILFNDLDTGQQLLVKVV   54 (109)
T ss_pred             hcCCCCCEEEEEEcCCCcEEEEEEE
Confidence            467999999996543 344555544


No 18 
>COG2002 AbrB Regulators of stationary/sporulation gene expression [Transcription]
Probab=39.76  E-value=47  Score=21.12  Aligned_cols=37  Identities=11%  Similarity=0.166  Sum_probs=26.8

Q ss_pred             CCEEEecccHHHHHhHhCCCCCCEEEEEEecC-cEEEEEEE
Q 040084           63 GRKVWFDDGWQDFVEAYSTFVGSLVLFEYESN-STFQAHIY  102 (127)
Q Consensus        63 ~~~~~~~~GW~~Fv~~~~L~~GD~lvF~~~~~-~~F~V~If  102 (127)
                      .+++.+=.   +..+..+|+.||.+.|...++ ...-+.=+
T Consensus        13 ~GqIvIPk---eiR~~lgi~~Gd~lei~~~~~~~~ivl~k~   50 (89)
T COG2002          13 KGQIVIPK---EIREALGIKEGDVLEIIVDGDGGRIVLKKY   50 (89)
T ss_pred             CceEEecH---HHHHHhCCCCCCEEEEEEeCCCCEEEEEEC
Confidence            46677665   456788999999999999986 45444433


No 19 
>TIGR02219 phage_NlpC_fam putative phage cell wall peptidase, NlpC/P60 family. Members of this family show sequence similarity to members of the NlpC/P60 family described by Pfam model pfam00877 and by Anantharaman and Aravind (PubMed:12620121). The NlpC/P60 family includes a number of characterized bacterial cell wall hydrolases. Members of this related family are all found in prophage regions of bacterial genomes.
Probab=38.93  E-value=46  Score=22.77  Aligned_cols=30  Identities=13%  Similarity=0.261  Sum_probs=21.9

Q ss_pred             hHhCCCCCCEEEEEEecC-cEEEEEEECCCC
Q 040084           77 EAYSTFVGSLVLFEYESN-STFQAHIYDETA  106 (127)
Q Consensus        77 ~~~~L~~GD~lvF~~~~~-~~F~V~If~~~~  106 (127)
                      ....|+.||++.|...+. ..-+|=||-.++
T Consensus        73 ~~~~~qpGDlvff~~~~~~~~~HvGIy~G~g  103 (134)
T TIGR02219        73 PCDAAQPGDVLVFRWRPGAAAKHAAIAASPT  103 (134)
T ss_pred             chhcCCCCCEEEEeeCCCCCCcEEEEEeCCC
Confidence            345799999999986543 346888886655


No 20 
>PF14326 DUF4384:  Domain of unknown function (DUF4384)
Probab=38.67  E-value=45  Score=20.73  Aligned_cols=33  Identities=24%  Similarity=0.327  Sum_probs=22.9

Q ss_pred             CCCCCEEEEEEecCcEEEEEEE--CCCC-eEEecCC
Q 040084           81 TFVGSLVLFEYESNSTFQAHIY--DETA-CEINYPS  113 (127)
Q Consensus        81 L~~GD~lvF~~~~~~~F~V~If--~~~~-ce~~~~~  113 (127)
                      ++.||.+.|.+..+..-.|.||  +.+| ....+|.
T Consensus         3 ~~~Ge~v~~~~~~~~~~Yl~l~~~~~~G~v~~L~Pn   38 (83)
T PF14326_consen    3 YRVGERVRFRVTSNRDGYLYLFYIDADGKVTLLFPN   38 (83)
T ss_pred             ccCCCEEEEEEEeCCCeEEEEEEECCCCCEEEEecC
Confidence            6789999999998655445555  5566 4556665


No 21 
>PF05382 Amidase_5:  Bacteriophage peptidoglycan hydrolase ;  InterPro: IPR008044 This entry is represented by Bacteriophage SFi21, lysin (Cell wall hydrolase; 3.5.1.28 from EC). At least one of proteins in this entry, the Pal protein from the pneumococcal bacteriophage Dp-1 (O03979 from SWISSPROT) has been shown to be an N-acetylmuramoyl-L-alanine amidase []. According to the known modular structure of this and other peptidoglycan hydrolases from the pneumococcal system, the active site should reside within this domain while a C-terminal domain binds to the choline residues of the cell wall teichoic acids [, ].
Probab=38.42  E-value=11  Score=26.76  Aligned_cols=42  Identities=17%  Similarity=0.307  Sum_probs=26.0

Q ss_pred             ecccHHHHHhH--hCCCCCCEEEEEEecCc---EEEEEEECCCCeEE
Q 040084           68 FDDGWQDFVEA--YSTFVGSLVLFEYESNS---TFQAHIYDETACEI  109 (127)
Q Consensus        68 ~~~GW~~Fv~~--~~L~~GD~lvF~~~~~~---~F~V~If~~~~ce~  109 (127)
                      ...||++....  ..++.||+|++...+.+   -=++-||-....-+
T Consensus        61 ~~~G~~~I~~~~~~~~q~GDI~I~g~~g~S~G~~GHtgif~~~~~iI  107 (145)
T PF05382_consen   61 KKNGFKKISENVDWNLQRGDIFIWGRRGNSAGAGGHTGIFMDNDTII  107 (145)
T ss_pred             hhCCcEEeccCCcccccCCCEEEEcCCCCCCCCCCeEEEEeCCCcEE
Confidence            36677666544  48999999999877633   12444554444333


No 22 
>PF06071 YchF-GTPase_C:  Protein of unknown function (DUF933);  InterPro: IPR013029 This domain is found at the C terminus of family of conserved hypothetical proteins found in both prokaryotes and eukaryotes. While the function of these proteins is not known, the crystal structure of P44681 from SWISSPROT from Haemophilus influenzae has been determined []. This protein consists of three domains: an N-terminal domain which has a mononucleotide binding fold typical for the P-loop NTPases, a central domain which forms an alpha-helical coiled coil, and this C-terminal domain which is composed of a six-stranded half-barrel curved around an alpha helix. The central domain and this domain are topologically similar to RNA-binding proteins, while the N-terminal region contains the features typical of GTP-dependent molecular switches. The purified protein was capable of binding both double-stranded nucleic acid and GTP. It was suggested, therefore, that this protein might be part of a nucleoprotein complex and could function as a GTP-dependent translation factor.; PDB: 1NI3_A 1JAL_A 2DWQ_B 2DBY_A 2OHF_A.
Probab=37.35  E-value=20  Score=23.11  Aligned_cols=15  Identities=20%  Similarity=0.556  Sum_probs=9.9

Q ss_pred             hHhCCCCCCEEEEEE
Q 040084           77 EAYSTFVGSLVLFEY   91 (127)
Q Consensus        77 ~~~~L~~GD~lvF~~   91 (127)
                      ++|-++.||++.|+.
T Consensus        69 K~YivqDGDIi~f~f   83 (84)
T PF06071_consen   69 KDYIVQDGDIIHFRF   83 (84)
T ss_dssp             TT-B--TTEEEEEEE
T ss_pred             CceeEeCCCEEEEEc
Confidence            467789999999975


No 23 
>KOG4146 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones]
Probab=37.16  E-value=22  Score=23.45  Aligned_cols=14  Identities=29%  Similarity=0.425  Sum_probs=12.4

Q ss_pred             hHhCCCCCCEEEEE
Q 040084           77 EAYSTFVGSLVLFE   90 (127)
Q Consensus        77 ~~~~L~~GD~lvF~   90 (127)
                      .+|.|+.||.++|.
T Consensus        82 edy~ledgD~ivfi   95 (101)
T KOG4146|consen   82 EDYPLEDGDHIVFI   95 (101)
T ss_pred             cccCcccCCEEEEE
Confidence            47899999999995


No 24 
>cd08316 Death_FAS_TNFRSF6 Death domain of FAS or TNF receptor superfamily member 6. Death Domain (DD) found in the FS7-associated cell surface antigen (FAS). FAS, also known as TNFRSF6 (TNF receptor superfamily member 6), APT1, CD95, FAS1, or APO-1, together with FADD (Fas-associating via Death Domain) and caspase 8, is an integral part of the death inducing signalling complex (DISC), which plays an important role in the induction of apoptosis and is activated by binding of the ligand FasL to FAS. FAS also plays a critical role in self-tolerance by eliminating cell types (autoreactive T and B cells) that contribute to autoimmunity. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in sign
Probab=36.73  E-value=13  Score=24.45  Aligned_cols=17  Identities=12%  Similarity=0.085  Sum_probs=14.4

Q ss_pred             ccHHHHHhHhCCCCCCE
Q 040084           70 DGWQDFVEAYSTFVGSL   86 (127)
Q Consensus        70 ~GW~~Fv~~~~L~~GD~   86 (127)
                      .-|++||...+|.++++
T Consensus        21 ~~wK~faR~lglse~~I   37 (97)
T cd08316          21 KDVKKFVRKSGLSEPKI   37 (97)
T ss_pred             HHHHHHHHHcCCCHHHH
Confidence            46999999999998753


No 25 
>cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=36.12  E-value=37  Score=21.83  Aligned_cols=16  Identities=19%  Similarity=0.569  Sum_probs=13.6

Q ss_pred             ceEEEEcCCCCEEEEE
Q 040084           43 DVAHITIPNGYVWQVK   58 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~   58 (127)
                      ..+.+.||+|+.|.+.
T Consensus        97 r~f~~~DPdGn~~~~~  112 (113)
T cd08356          97 REFFLHDPSGVLWHIG  112 (113)
T ss_pred             EEEEEECCCccEEEee
Confidence            5789999999999873


No 26 
>TIGR03511 GldH_lipo gliding motility-associated lipoprotein GldH. Members of this protein family are predicted lipoproteins, exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). Members include GldH, a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Not all Bacteroidetes with members of this protein family may have gliding motility.
Probab=36.01  E-value=26  Score=25.07  Aligned_cols=32  Identities=22%  Similarity=0.476  Sum_probs=21.5

Q ss_pred             ceEEEEcCCCCEEE---EEEEE-eCCEEEecccHHH
Q 040084           43 DVAHITIPNGYVWQ---VKLKK-EGRKVWFDDGWQD   74 (127)
Q Consensus        43 ~~v~L~~~~G~~W~---V~l~~-~~~~~~~~~GW~~   74 (127)
                      -.+.++.|+|+.|.   +++.- ...+.|++.||..
T Consensus        76 l~~~~~~~~~~~~~~DTl~~~Lad~~G~w~G~G~g~  111 (156)
T TIGR03511        76 ALIHENLEDSTVIFTDTVDLTLADSTGQWTGKGWGS  111 (156)
T ss_pred             EEEEEEcCCCceEEeeeeEEEeeCCCCCEEeeeecc
Confidence            45667788999983   33332 3467789999953


No 27 
>KOG0260 consensus RNA polymerase II, large subunit [Transcription]
Probab=35.86  E-value=58  Score=30.95  Aligned_cols=77  Identities=17%  Similarity=0.252  Sum_probs=52.0

Q ss_pred             EEEeccCC-ccCCCceeccHHHHHhcc---------------------cCCCc-eEEEEcCCCCEEEEEEEEeCCEEEec
Q 040084           13 FVKAVLPS-TLRDQKPRIPNKIVRKFS---------------------HELSD-VAHITIPNGYVWQVKLKKEGRKVWFD   69 (127)
Q Consensus        13 F~k~i~~~-~~~~~~L~IP~~F~~~~~---------------------~~~~~-~v~L~~~~G~~W~V~l~~~~~~~~~~   69 (127)
                      +=+||+++ +++-+.+-||...|+.+-                     .+.++ +-++++ +|..-...+.++.+..-|+
T Consensus       341 aRTVItgDPnl~ldevGVP~sIAk~lTfpE~Vtp~NidrLqeLV~~g~~~~pgakyiird-~G~Ridlr~~~~~~d~~Lq  419 (1605)
T KOG0260|consen  341 ARTVITGDPNLSLDEVGVPRSIAKRLTFPEHVTPFNIDRLQELVRRGLLEHPGAKYIIRD-NGDRIDLRYHKRAGDIHLQ  419 (1605)
T ss_pred             eeeeecCCCCcchhcccCcHHHHhhccCcceeccccHHHHHHHhhCCCCCCCCcceeeec-CCcEEEEeecCCccccccc
Confidence            44567774 454577888988887651                     11222 333443 5776666776666777899


Q ss_pred             ccHHHHHhHhCCCCCCEEEEEEec
Q 040084           70 DGWQDFVEAYSTFVGSLVLFEYES   93 (127)
Q Consensus        70 ~GW~~Fv~~~~L~~GD~lvF~~~~   93 (127)
                      .||+-+   -+|+.||+++|.-.-
T Consensus       420 ~G~kVe---Rhl~DGD~VlfNRqP  440 (1605)
T KOG0260|consen  420 PGYKVE---RHLMDGDVVLFNRQP  440 (1605)
T ss_pred             cccEEE---EeeccCCEEEEcCCC
Confidence            999854   579999999997654


No 28 
>PRK09974 putative regulator PrlF; Provisional
Probab=33.76  E-value=1.2e+02  Score=20.62  Aligned_cols=28  Identities=7%  Similarity=-0.057  Sum_probs=22.3

Q ss_pred             HHHHhHhCCCCCCEEEEEEecCcEEEEE
Q 040084           73 QDFVEAYSTFVGSLVLFEYESNSTFQAH  100 (127)
Q Consensus        73 ~~Fv~~~~L~~GD~lvF~~~~~~~F~V~  100 (127)
                      ++..+.-+|+.||.+.|....+....+.
T Consensus        24 k~IR~~Lgl~~GdkI~f~i~~dG~V~i~   51 (111)
T PRK09974         24 APVRKALKLKKRDSIHYEILPGGQVFIC   51 (111)
T ss_pred             HHHHHHcCCCCCCEEEEEEeCCCEEEEE
Confidence            5677889999999999998866655444


No 29 
>KOG1114 consensus Tripeptidyl peptidase II [Posttranslational modification, protein turnover, chaperones]
Probab=33.74  E-value=1.6e+02  Score=27.57  Aligned_cols=91  Identities=15%  Similarity=0.265  Sum_probs=56.4

Q ss_pred             CceeccHHHHHhcccCCCceEEEEcCCCCEEEEEEEEe-CCEEEecccHHHHHhHhCCCCCCEEEEEEecCcEEEEEEEC
Q 040084           25 QKPRIPNKIVRKFSHELSDVAHITIPNGYVWQVKLKKE-GRKVWFDDGWQDFVEAYSTFVGSLVLFEYESNSTFQAHIYD  103 (127)
Q Consensus        25 ~~L~IP~~F~~~~~~~~~~~v~L~~~~G~~W~V~l~~~-~~~~~~~~GW~~Fv~~~~L~~GD~lvF~~~~~~~F~V~If~  103 (127)
                      +.+..=+.++++|.+..+--=.+.-++|..|+|-+... .|.+++..--.+|-..+...     .|.-..-..+.|+|||
T Consensus       224 ~kve~Lks~a~ky~D~gpvyD~vvwhdgE~Wrv~iDt~~~Gdl~~~~~L~~~~~t~e~~-----~f~~~d~l~ysV~vyd  298 (1304)
T KOG1114|consen  224 SKVEFLKSLAKKYDDPGPVYDVVVWHDGEVWRVCIDTDETGDLYLHKVLGEFNETGEYA-----TFGSLDLLSYSVNVYD  298 (1304)
T ss_pred             HHHHHHHHHHHhcCCCCcceEEEEeecCCeEEEEecccccCcccccccccccccccccc-----ccccccccceeEEEcc
Confidence            34455567888888776654444557899999999764 56777666555554444333     2222223457788998


Q ss_pred             C-CCeEEecCCCCCCcCC
Q 040084          104 E-TACEINYPSSNEESHT  120 (127)
Q Consensus       104 ~-~~ce~~~~~~~~~~~~  120 (127)
                      . +-.+++.+++--..+.
T Consensus       299 ~gnvlsIV~~Sg~HGTHV  316 (1304)
T KOG1114|consen  299 DGNVLSIVTVSGPHGTHV  316 (1304)
T ss_pred             CCceEEEEecCCCCccee
Confidence            7 5567777765444443


No 30 
>PF02938 GAD:  GAD domain;  InterPro: IPR004115 This entry represetns an 2 layer alpha/beta insertion domain found in some glutamyl-tRNA amidotransferases and aspartyl tRNA synthetases [, ]. The function of this domain is not yet known.; GO: 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0005737 cytoplasm; PDB: 1ZQ1_D 1EQR_B 1IL2_B 1C0A_A 1L0W_A 1G51_B 1EFW_B 2D6F_D.
Probab=33.44  E-value=39  Score=21.68  Aligned_cols=25  Identities=20%  Similarity=0.377  Sum_probs=18.7

Q ss_pred             cccHHHHHhHhCCCCCCEEEEEEec
Q 040084           69 DDGWQDFVEAYSTFVGSLVLFEYES   93 (127)
Q Consensus        69 ~~GW~~Fv~~~~L~~GD~lvF~~~~   93 (127)
                      ..-=+++....+++.||.|.|--..
T Consensus        63 e~~~~~l~~~~~a~~GD~ll~~Ag~   87 (95)
T PF02938_consen   63 EEELKALIERLGAKPGDLLLFVAGK   87 (95)
T ss_dssp             HHHHHHHHHHTT--TTEEEEEEEES
T ss_pred             HHHHHHHHHHhCCCCCCEEEEECCC
Confidence            5556889999999999999997543


No 31 
>cd08306 Death_FADD Fas-associated Death Domain protein-protein interaction domain. Death domain (DD) found in FAS-associated via death domain (FADD). FADD is a component of the death-inducing signaling complex (DISC) and serves as an adaptor in the signaling pathway of death receptor proteins. It modulates apoptosis as well as non-apoptotic processes such as cell cycle progression, survival, innate immune signaling, and hematopoiesis. FADD contains an N-terminal DED and a C-terminal DD. Its DD interacts with the DD of the activated death receptor, FAS, and its DED recruits the initiator caspases, caspase-8 and -10, to the DISC complex via a homotypic interaction with the N-terminal DED of the caspase. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain),
Probab=33.20  E-value=11  Score=24.03  Aligned_cols=21  Identities=5%  Similarity=0.169  Sum_probs=17.5

Q ss_pred             ecccHHHHHhHhCCCCCCEEE
Q 040084           68 FDDGWQDFVEAYSTFVGSLVL   88 (127)
Q Consensus        68 ~~~GW~~Fv~~~~L~~GD~lv   88 (127)
                      ++..|++|+..-+|.++|+=.
T Consensus        12 lG~~Wk~laR~LGlse~~Id~   32 (86)
T cd08306          12 VGRDWRKLARKLGLSETKIES   32 (86)
T ss_pred             HhhhHHHHHHHcCCCHHHHHH
Confidence            567899999999999887543


No 32 
>PF11320 DUF3122:  Protein of unknown function (DUF3122);  InterPro: IPR021469  This family of proteins with unknown function appear to be restricted to Cyanobacteria. 
Probab=32.90  E-value=1.1e+02  Score=21.45  Aligned_cols=19  Identities=32%  Similarity=0.449  Sum_probs=16.0

Q ss_pred             eEEEEcCCCCEEEEEEEEe
Q 040084           44 VAHITIPNGYVWQVKLKKE   62 (127)
Q Consensus        44 ~v~L~~~~G~~W~V~l~~~   62 (127)
                      .-.|+|-+|++|.|-+-++
T Consensus        18 ~qsLrD~~g~sWQvV~fkr   36 (134)
T PF11320_consen   18 RQSLRDQDGNSWQVVLFKR   36 (134)
T ss_pred             eeeecCCCCCceEEEEEEe
Confidence            4478899999999999775


No 33 
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II).  The protein superfamily contains members with or without domain swapping.
Probab=32.44  E-value=57  Score=20.97  Aligned_cols=16  Identities=19%  Similarity=0.341  Sum_probs=13.7

Q ss_pred             eEEEEcCCCCEEEEEE
Q 040084           44 VAHITIPNGYVWQVKL   59 (127)
Q Consensus        44 ~v~L~~~~G~~W~V~l   59 (127)
                      .+.++||+|+.|.+..
T Consensus       108 ~~~~~DPdG~~ie~~~  123 (124)
T cd09012         108 GRSFADLDGHLWEVLW  123 (124)
T ss_pred             EEEEECCCCCEEEEEE
Confidence            5789999999999864


No 34 
>PF09147 DUF1933:  Domain of unknown function (DUF1933);  InterPro: IPR015230 This domain is predominantly found in carbapenam synthetase, and is composed of two antiparallel six-stranded beta-sheets that form a sandwich, flanked on each side by two alpha-helices. Their exact function has not, as yet, been determined []. ; PDB: 1Q19_A 1Q15_D.
Probab=32.24  E-value=59  Score=24.15  Aligned_cols=24  Identities=21%  Similarity=0.245  Sum_probs=18.3

Q ss_pred             hHhCCCCCCEEEEEEecCcEEEEE
Q 040084           77 EAYSTFVGSLVLFEYESNSTFQAH  100 (127)
Q Consensus        77 ~~~~L~~GD~lvF~~~~~~~F~V~  100 (127)
                      .+-.|.+||+|.|.-+.+.++.|.
T Consensus        93 ~aLsLAEGdfcffiE~kng~L~l~  116 (201)
T PF09147_consen   93 SALSLAEGDFCFFIEDKNGELTLI  116 (201)
T ss_dssp             GGGGG--SSEEEEEEETTSEEEEE
T ss_pred             hhhhhhcCceEEEEecCCCcEEEE
Confidence            456899999999999998888764


No 35 
>cd04867 TGS_YchF_C TGS_YchF_C: This subfamily represents TGS domain-containing YchF GTP-binding protein, a universally conserved GTPase whose function is unknown. The N-terminal domain of the YchF protein belongs to the Obg-like family of GTPases, and some members of the family contain a C-terminal TGS domain. TGS is a small domain of about 50 amino acid residues with a predominantly beta-sheet structure. There is no direct information on the function of the TGS domain, but its presence in two types of regulatory proteins (the GTPases and guanosine polyphosphate phosphohydrolases/synthetases) suggests a ligand (most likely nucleotide)-binding, regulatory role.
Probab=31.98  E-value=19  Score=23.20  Aligned_cols=14  Identities=21%  Similarity=0.698  Sum_probs=11.4

Q ss_pred             HhCCCCCCEEEEEE
Q 040084           78 AYSTFVGSLVLFEY   91 (127)
Q Consensus        78 ~~~L~~GD~lvF~~   91 (127)
                      +|-++.||++.|++
T Consensus        70 ~Yiv~DGDi~~f~f   83 (83)
T cd04867          70 DYVVQDGDIIFFKF   83 (83)
T ss_pred             ceEeeCCeEEEEEC
Confidence            67789999999863


No 36 
>cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The structures of this family demonstrate  domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins.
Probab=31.49  E-value=53  Score=20.96  Aligned_cols=16  Identities=19%  Similarity=0.399  Sum_probs=13.2

Q ss_pred             ceEEEEcCCCCEEEEE
Q 040084           43 DVAHITIPNGYVWQVK   58 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~   58 (127)
                      ..+.++||+|+.|.+.
T Consensus       105 ~~~~~~DPdG~~~~l~  120 (122)
T cd08355         105 REFTARDPEGNLWTFG  120 (122)
T ss_pred             EEEEEECCCCCEEEEe
Confidence            4578999999999874


No 37 
>PF01568 Molydop_binding:  Molydopterin dinucleotide binding domain;  InterPro: IPR006657 A domain in this entry corresponds to the C-terminal domain IV in dimethyl sulphoxide (DMSO)reductase which interacts with the 2-amino pyrimidone ring of both molybdopterin guanine dinucleotide molecules [].; GO: 0016491 oxidoreductase activity, 0030151 molybdenum ion binding, 0055114 oxidation-reduction process; PDB: 2IVF_A 1OGY_G 3ML1_A 3O5A_A 1TI2_G 1VLE_M 1VLD_U 1VLF_O 1TI4_I 1TI6_E ....
Probab=30.71  E-value=1.4e+02  Score=18.83  Aligned_cols=48  Identities=21%  Similarity=0.327  Sum_probs=35.6

Q ss_pred             ceeccHHHHHhcccCCCceEEEEcCCCCEEEEEEEEe----CCEEEecccHHH
Q 040084           26 KPRIPNKIVRKFSHELSDVAHITIPNGYVWQVKLKKE----GRKVWFDDGWQD   74 (127)
Q Consensus        26 ~L~IP~~F~~~~~~~~~~~v~L~~~~G~~W~V~l~~~----~~~~~~~~GW~~   74 (127)
                      .+.|.+.=+++++-+..+.|.|.++.| .-.+.+...    .+.+++..||..
T Consensus        31 ~v~inp~dA~~~Gi~~Gd~V~v~s~~G-~v~~~v~~~~~v~~g~v~~~~~~~~   82 (110)
T PF01568_consen   31 FVEINPEDAAKLGIKDGDWVRVSSPRG-SVEVRVKVTDGVPPGVVFMPHGWGG   82 (110)
T ss_dssp             EEEEEHHHHHHCT--TTCEEEEEETTE-EEEEEEEEETTS-TTEEEEESTHTT
T ss_pred             EEEEcHHHHHHhcCcCCCEEEEEeccc-eEeeeeEEecCCcCCEEEEeccccc
Confidence            678888889999988899999999988 334444433    578888888876


No 38 
>COG1525 Micrococcal nuclease (thermonuclease) homologs [DNA replication, recombination, and repair]
Probab=30.35  E-value=56  Score=23.49  Aligned_cols=43  Identities=14%  Similarity=0.128  Sum_probs=32.6

Q ss_pred             CCCCCCEEEEEEecCcEEEEEEECCCCeEEecCCCCCCcCCCC
Q 040084           80 STFVGSLVLFEYESNSTFQAHIYDETACEINYPSSNEESHTNG  122 (127)
Q Consensus        80 ~L~~GD~lvF~~~~~~~F~V~If~~~~ce~~~~~~~~~~~~~~  122 (127)
                      .+..||.+.....+...-+|.+.+-+.+|...++.+...+-+|
T Consensus        48 ~v~dGDT~~v~~~~~~~~~iRl~gIdaPe~~~~~~~~~~~~~G   90 (192)
T COG1525          48 RVIDGDTLKVRGEGGQAVKIRLAGIDAPETKQTCAGGKSQPCG   90 (192)
T ss_pred             EecCCCeEEEecCCCceeEEEEeccCCCcccccCCcccccchH
Confidence            3467888888888888999999999999988776444444444


No 39 
>PF04225 OapA:  Opacity-associated protein A LysM-like domain;  InterPro: IPR007340 This entry includes the Haemophilus influenzae opacity-associated protein. This protein is required for efficient nasopharyngeal mucosal colonization, and its expression is associated with a distinctive transparent colony phenotype. OapA is thought to be a secreted protein, and its expression exhibits high-frequency phase variation [].; PDB: 2GU1_A.
Probab=30.14  E-value=59  Score=20.62  Aligned_cols=33  Identities=15%  Similarity=0.267  Sum_probs=17.9

Q ss_pred             CCCCCCEEEEEEecCcEEEEEEECCCCeEEecC
Q 040084           80 STFVGSLVLFEYESNSTFQAHIYDETACEINYP  112 (127)
Q Consensus        80 ~L~~GD~lvF~~~~~~~F~V~If~~~~ce~~~~  112 (127)
                      .|+.||.|.|.++.+..+.-.-+..+.-+..|.
T Consensus        42 ~L~pGq~l~f~~d~~g~L~~L~~~~~~~~~~~~   74 (85)
T PF04225_consen   42 RLKPGQTLEFQLDEDGQLTALRYERSPKTTLYT   74 (85)
T ss_dssp             G--TT-EEEEEE-TTS-EEEEEEEEETTEEEEE
T ss_pred             hCCCCCEEEEEECCCCCEEEEEEEcCCcEEEEE
Confidence            589999999999987766544444433344443


No 40 
>PF08916 Phe_ZIP:  Phenylalanine zipper;  InterPro: IPR015012 The phenylalanine zipper consists of aromatic side chains from ten phenylalanine residues that are stacked within a hydrophobic core. This zipper mediates dimerisation of various proteins, such as APS, SH2-B and Lnk []. ; GO: 0004871 signal transducer activity, 0035556 intracellular signal transduction; PDB: 1Q2H_B.
Probab=29.63  E-value=32  Score=20.71  Aligned_cols=10  Identities=40%  Similarity=1.069  Sum_probs=6.4

Q ss_pred             ccHHHHHhHh
Q 040084           70 DGWQDFVEAY   79 (127)
Q Consensus        70 ~GW~~Fv~~~   79 (127)
                      .||.+|+.-|
T Consensus         1 ~~W~EFCE~H   10 (59)
T PF08916_consen    1 PGWREFCERH   10 (59)
T ss_dssp             --HHHHHHHH
T ss_pred             CCHHHHHHHH
Confidence            3899998755


No 41 
>cd07235 MRD Mitomycin C resistance protein (MRD). Mitomycin C (MC) is a naturally occurring antibiotic, and antitumor agent used in the treatment of cancer. Its antitumor activity is exerted primarily through monofunctional and bifunctional alkylation of DNA. MRD binds to MC and functions as a component of the MC exporting system. MC is bound to MRD by a stacking interaction between a His and a Trp. MRD adopts a structural fold similar to bleomycin resistance protein, glyoxalase I, and extradiol dioxygenases; and it has binding sites at an identical location to binding sites in these evolutionarily related enzymes.
Probab=29.45  E-value=56  Score=20.80  Aligned_cols=16  Identities=19%  Similarity=0.248  Sum_probs=13.1

Q ss_pred             ceEEEEcCCCCEEEEE
Q 040084           43 DVAHITIPNGYVWQVK   58 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~   58 (127)
                      ..+.++||+|+.|.+-
T Consensus       106 ~~~~~~DPdG~~iel~  121 (122)
T cd07235         106 RYAIVKDPDGNLVDLF  121 (122)
T ss_pred             EEEEEECCCCCEEEEe
Confidence            3568999999999874


No 42 
>cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and types I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=29.27  E-value=89  Score=19.79  Aligned_cols=19  Identities=32%  Similarity=0.615  Sum_probs=15.7

Q ss_pred             ceEEEEcCCCCEEEEEEEE
Q 040084           43 DVAHITIPNGYVWQVKLKK   61 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~l~~   61 (127)
                      ..+.++||+|+.|.+....
T Consensus       100 ~~~~~~DP~G~~ie~~~~~  118 (120)
T cd07254         100 DKVWVTDPDGNAWEVFVTL  118 (120)
T ss_pred             ceEEEECCCCCEEEEEEee
Confidence            3588999999999998743


No 43 
>PF01052 SpoA:  Surface presentation of antigens (SPOA);  InterPro: IPR001543 Proteins in this group are involved in a secretory pathway responsible for the surface presentation of invasion plasmid antigen needed for the entry of Salmonella and other species into mammalian cells [, ].They could play a role in preserving the translocation competence of the IPA antigens and are required for secretion of the three IPA proteins [].  The C-terminal region of flagellar motor switch proteins FliN and FliM is also included in this entry. ; PDB: 3UEP_A 1O9Y_B 1YAB_A.
Probab=28.74  E-value=64  Score=19.51  Aligned_cols=27  Identities=11%  Similarity=0.255  Sum_probs=17.3

Q ss_pred             HHhHhCCCCCCEEEEEEecCcEEEEEE
Q 040084           75 FVEAYSTFVGSLVLFEYESNSTFQAHI  101 (127)
Q Consensus        75 Fv~~~~L~~GD~lvF~~~~~~~F~V~I  101 (127)
                      ...-.+|+.||++.+...-+....|.+
T Consensus        23 l~el~~L~~Gdvi~l~~~~~~~v~l~v   49 (77)
T PF01052_consen   23 LGELLNLKVGDVIPLDKPADEPVELRV   49 (77)
T ss_dssp             HHHHHC--TT-EEEECCESSTEEEEEE
T ss_pred             HHHHhcCCCCCEEEeCCCCCCCEEEEE
Confidence            345678999999999888666666654


No 44 
>PF12681 Glyoxalase_2:  Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A ....
Probab=28.71  E-value=59  Score=20.00  Aligned_cols=15  Identities=13%  Similarity=0.087  Sum_probs=11.1

Q ss_pred             ceEEEEcCCCCEEEE
Q 040084           43 DVAHITIPNGYVWQV   57 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V   57 (127)
                      ..+.++||+|+.|.+
T Consensus        93 ~~~~~~DPdG~~ie~  107 (108)
T PF12681_consen   93 RSFYFIDPDGNRIEF  107 (108)
T ss_dssp             EEEEEE-TTS-EEEE
T ss_pred             EEEEEECCCCCEEEe
Confidence            588999999999876


No 45 
>PRK06033 hypothetical protein; Validated
Probab=28.68  E-value=61  Score=20.57  Aligned_cols=26  Identities=4%  Similarity=0.024  Sum_probs=17.4

Q ss_pred             HHHhHhCCCCCCEEEEEEecCcEEEE
Q 040084           74 DFVEAYSTFVGSLVLFEYESNSTFQA   99 (127)
Q Consensus        74 ~Fv~~~~L~~GD~lvF~~~~~~~F~V   99 (127)
                      .+..--+|++||++.+....+....|
T Consensus        21 ~l~dlL~L~~GDVI~L~~~~~~~v~v   46 (83)
T PRK06033         21 PIHQVLRMGRGAVIPLDATEADEVWI   46 (83)
T ss_pred             cHHHHhCCCCCCEEEeCCCCCCcEEE
Confidence            34556789999999997654433333


No 46 
>COG5131 URM1 Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones]
Probab=28.04  E-value=39  Score=22.14  Aligned_cols=24  Identities=21%  Similarity=0.440  Sum_probs=16.5

Q ss_pred             cccHHHHHh-HhCCCCCCEEEEEEe
Q 040084           69 DDGWQDFVE-AYSTFVGSLVLFEYE   92 (127)
Q Consensus        69 ~~GW~~Fv~-~~~L~~GD~lvF~~~   92 (127)
                      ...|.-.-+ ++.|+.||.++|.-.
T Consensus        68 d~DWeLleke~y~ledgDiIvfist   92 (96)
T COG5131          68 DMDWELLEKERYPLEDGDIIVFIST   92 (96)
T ss_pred             CccHhhhhcccccCCCCCEEEEEec
Confidence            344554443 688999999999643


No 47 
>PF14109 GldH_lipo:  GldH lipoprotein
Probab=27.91  E-value=54  Score=22.51  Aligned_cols=58  Identities=21%  Similarity=0.250  Sum_probs=35.0

Q ss_pred             CceEEEEcCCCCEEEEEEEE---eCCEEEecccHHHHHhHhCCCCCCEEEEEEecCcEEEEE
Q 040084           42 SDVAHITIPNGYVWQVKLKK---EGRKVWFDDGWQDFVEAYSTFVGSLVLFEYESNSTFQAH  100 (127)
Q Consensus        42 ~~~v~L~~~~G~~W~V~l~~---~~~~~~~~~GW~~Fv~~~~L~~GD~lvF~~~~~~~F~V~  100 (127)
                      --.+.+..|+|+...=.+..   ...+-|++.||.. +.++.+-.-.-+.|...|.-+|.|.
T Consensus        53 ~l~v~~~~p~~~~~~dtl~~~Lad~~G~w~G~G~~~-~~e~~~~~~~~~~f~~~G~Y~~~i~  113 (131)
T PF14109_consen   53 WLIVELTDPDGKKVTDTLECELADPDGKWLGKGIGD-LYEYKLPYKENVRFPRKGSYTFTIE  113 (131)
T ss_pred             EEEEEEEcCCCCEEeeeEEEEEECCCCcEeeeeEeE-eEEEEEEeecceecCCCCcEEEEEE
Confidence            34677778888874433332   2456788999887 5555555544555554555555544


No 48 
>cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The structures of this family demonstrate  domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins.
Probab=27.66  E-value=67  Score=20.15  Aligned_cols=17  Identities=18%  Similarity=0.362  Sum_probs=13.9

Q ss_pred             CceEEEEcCCCCEEEEE
Q 040084           42 SDVAHITIPNGYVWQVK   58 (127)
Q Consensus        42 ~~~v~L~~~~G~~W~V~   58 (127)
                      ...+.++||+|..|.+.
T Consensus       104 ~~~~~~~DP~G~~~~l~  120 (122)
T cd07246         104 DRYGGVRDPFGHRWWIA  120 (122)
T ss_pred             ceEEEEECCCCCEEEEe
Confidence            35889999999999864


No 49 
>cd03548 Rieske_RO_Alpha_OMO_CARDO Rieske non-heme iron oxygenase (RO) family, 2-Oxoquinoline 8-monooxygenase (OMO) and Carbazole 1,9a-dioxygenase (CARDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. OMO catalyzes the NADH-dependent oxidation of the N-heterocyclic aromatic compound 2-oxoquinoline to 8-hydroxy-2-oxoquinoline, the second step in the bacterial degradation of quinoline. OMO consists of a reductase component (OMR) and  an oxygenase component (OMO) that together function to shuttle electrons from the
Probab=27.51  E-value=34  Score=23.44  Aligned_cols=38  Identities=8%  Similarity=-0.026  Sum_probs=27.4

Q ss_pred             EEecccHHHHHhHhCCCCCCEEEEEEecCcEEEEEEECCCC
Q 040084           66 VWFDDGWQDFVEAYSTFVGSLVLFEYESNSTFQAHIYDETA  106 (127)
Q Consensus        66 ~~~~~GW~~Fv~~~~L~~GD~lvF~~~~~~~F~V~If~~~~  106 (127)
                      .-|..+|-..+....|..|+...|++.+..   +.|++.+|
T Consensus         9 ~~~~~~W~~v~~~~el~~g~~~~~~~~g~~---i~l~r~~g   46 (136)
T cd03548           9 WGFRNHWYPALFSHELEEGEPKGIQLCGEP---ILLRRVDG   46 (136)
T ss_pred             cCcccCcEEEEEHHHCCCCCeEEEEECCcE---EEEEecCC
Confidence            356788887788888999999999987654   34444443


No 50 
>PF07494 Reg_prop:  Two component regulator propeller;  InterPro: IPR011110 A large group of two component regulator proteins appear to have the same N-terminal structure of 14 tandem repeats. These repeats show homology to members of IPR002372 from INTERPRO and IPR001680 from INTERPRO indicating that they are likely to form a beta-propeller. This family has been built with artificially high cut-offs in order to avoid overlaps with other beta-propeller families. The fourteen repeats are likely to form two propellers; it is not clear if these structures are likely to recruit other proteins or interact with DNA.; PDB: 3V9F_D 3VA6_B 3OTT_B 4A2M_D 4A2L_B.
Probab=27.49  E-value=74  Score=15.01  Aligned_cols=13  Identities=15%  Similarity=0.389  Sum_probs=8.8

Q ss_pred             eEEEEcCCCCEEE
Q 040084           44 VAHITIPNGYVWQ   56 (127)
Q Consensus        44 ~v~L~~~~G~~W~   56 (127)
                      ...++|++|+-|-
T Consensus         8 ~~i~~D~~G~lWi   20 (24)
T PF07494_consen    8 YSIYEDSDGNLWI   20 (24)
T ss_dssp             EEEEE-TTSCEEE
T ss_pred             EEEEEcCCcCEEE
Confidence            4567888888884


No 51 
>PF02381 MraZ:  MraZ protein;  InterPro: IPR020603 this entry represents the 70 amino acid region found duplicated in the bacterial proteins MraZ. These proteins may be DNA-binding transcription factors, its members are probably enzymes containing a conserved DXXXR motif that probably forms part of the active site.; PDB: 1N0F_E 1N0E_F 1N0G_A.
Probab=27.19  E-value=88  Score=18.71  Aligned_cols=42  Identities=14%  Similarity=0.336  Sum_probs=25.7

Q ss_pred             CceeccHHHHHhcccCCCceEEEEcCCCCEEEEEEEEeCCEEEecccHHHHHhH
Q 040084           25 QKPRIPNKIVRKFSHELSDVAHITIPNGYVWQVKLKKEGRKVWFDDGWQDFVEA   78 (127)
Q Consensus        25 ~~L~IP~~F~~~~~~~~~~~v~L~~~~G~~W~V~l~~~~~~~~~~~GW~~Fv~~   78 (127)
                      .++.||..|-+..+..  ..+++.+.++ +-         .+|=...|.++...
T Consensus        14 GRi~iP~~~R~~l~~~--~~v~~~g~~~-~l---------eiw~~~~w~~~~~~   55 (72)
T PF02381_consen   14 GRISIPAKFREHLGIE--KEVVFVGFDD-CL---------EIWPPEEWEELEAR   55 (72)
T ss_dssp             SEEE--CHHHHHTTSC--SEEEEEECCS-EE---------EEEEHHHHHHHHHC
T ss_pred             CCEecCHHHHhhhccC--ceEEEeccCC-EE---------EEcCHHHHHHHHHH
Confidence            8899999998876665  6666665432 11         13346778777765


No 52 
>TIGR01643 YD_repeat_2x YD repeat (two copies). This model describes two tandem copies of a 21-residue extracellular repeat found in Gram-negative, Gram-positive, and animal proteins. The repeat is named for a YD dipeptide, the most strongly conserved motif of the repeat. These repeats appear in general to be involved in binding carbohydrate; the chicken teneurin-1 YD-repeat region has been shown to bind heparin.
Probab=26.88  E-value=1.1e+02  Score=16.02  Aligned_cols=21  Identities=10%  Similarity=0.039  Sum_probs=16.3

Q ss_pred             CceEEEEcCCCCEEEEEEEEe
Q 040084           42 SDVAHITIPNGYVWQVKLKKE   62 (127)
Q Consensus        42 ~~~v~L~~~~G~~W~V~l~~~   62 (127)
                      ...+.+.+|+|+.|...+...
T Consensus         5 g~l~~~~~p~G~~~~~~YD~~   25 (42)
T TIGR01643         5 GRLTGSTDADGTTTRYTYDAA   25 (42)
T ss_pred             CCEEEEECCCCCEEEEEECCC
Confidence            456788889999999888543


No 53 
>cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD). Rho protein is a transcription termination factor in most bacteria. In bacteria, there are two distinct mechanisms for mRNA transcription termination. In intrinsic termination, RNA polymerase and nascent mRNA are released from DNA template by an mRNA stem loop structure, which resembles the transcription termination mechanism used by eukaryotic pol III. The second mechanism is mediated by Rho factor. Rho factor terminates transcription by using energy from ATP hydrolysis to forcibly dissociate the transcripts from RNA polymerase. Rho protein contains an N-terminal S1-like domain, which binds single-stranded RNA. Rho has a C-terminal ATPase domain which hydrolyzes ATP to provide energy to strip RNA polymerase and mRNA from the DNA template. Rho functions as a homohexamer.
Probab=26.61  E-value=70  Score=19.64  Aligned_cols=24  Identities=8%  Similarity=0.246  Sum_probs=18.0

Q ss_pred             CEEEecccHHHHHhHhCCCCCCEEEEE
Q 040084           64 RKVWFDDGWQDFVEAYSTFVGSLVLFE   90 (127)
Q Consensus        64 ~~~~~~~GW~~Fv~~~~L~~GD~lvF~   90 (127)
                      +.++..   ...++.++|+.||.+.=.
T Consensus        27 ~DvyVs---~~~Irr~~LR~GD~V~G~   50 (68)
T cd04459          27 DDIYVS---PSQIRRFNLRTGDTVVGQ   50 (68)
T ss_pred             CCEEEC---HHHHHHhCCCCCCEEEEE
Confidence            445544   478999999999998643


No 54 
>PF00877 NLPC_P60:  NlpC/P60 family;  InterPro: IPR000064 The Escherichia coli NLPC/Listeria P60 domain occurs at the C terminus of a number of different bacterial and viral proteins. The viral proteins are either described as tail assembly proteins or Gp19. In bacteria, the proteins are variously described as being putative tail component of prophage, invasin, invasion associated protein, putative lipoprotein, cell wall hydrolase, or putative endopeptidase.  The E. coli NLPC/Listeria P60 domain is contained within the boundaries of the cysteine peptidase domain that defines the MEROPS peptidase family C40 (clan C-). A type example being dipeptidyl-peptidase VI from Bacillus sphaericus and gamma-glutamyl-diamino acid-endopeptidase precursor from Lactococcus lactis 3.4.19.11 from EC. This group also contains proteins classified as non-peptidase homologues in that they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity of peptidases in the C40 family. ; PDB: 3PVQ_B 3GT2_A 3NPF_B 2K1G_A 3I86_A 3S0Q_A 2XIV_A 3PBC_A 3NE0_A 3M1U_B ....
Probab=26.40  E-value=46  Score=21.28  Aligned_cols=32  Identities=19%  Similarity=0.185  Sum_probs=23.5

Q ss_pred             HHHhHhCCCCCCEEEEEEecCcEEEEEEECCCC
Q 040084           74 DFVEAYSTFVGSLVLFEYESNSTFQAHIYDETA  106 (127)
Q Consensus        74 ~Fv~~~~L~~GD~lvF~~~~~~~F~V~If~~~~  106 (127)
                      .++....++.||++.|.. +...-+|-||-.++
T Consensus        45 ~~~~~~~~~pGDlif~~~-~~~~~Hvgiy~g~~   76 (105)
T PF00877_consen   45 KRVPISELQPGDLIFFKG-GGGISHVGIYLGDG   76 (105)
T ss_dssp             EHEEGGG-TTTEEEEEEG-TGGEEEEEEEEETT
T ss_pred             cccchhcCCcccEEEEeC-CccCCEeEEEEeCC
Confidence            356677899999999998 66677777776544


No 55 
>KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism]
Probab=26.35  E-value=39  Score=25.82  Aligned_cols=25  Identities=12%  Similarity=0.274  Sum_probs=22.4

Q ss_pred             HhHhCCCCCCEEEEEEecCcEEEEE
Q 040084           76 VEAYSTFVGSLVLFEYESNSTFQAH  100 (127)
Q Consensus        76 v~~~~L~~GD~lvF~~~~~~~F~V~  100 (127)
                      .++|+|.+|.-..|+..|++.++|.
T Consensus        45 RkdyHieegeE~FyQ~KGdMvLKVi   69 (279)
T KOG3995|consen   45 RKDYHIEEGEEVFYQLKGDMVLKVL   69 (279)
T ss_pred             ccccccCCcchhheeecCceEEeee
Confidence            4789999999999999999998875


No 56 
>COG5285 Protein involved in biosynthesis of mitomycin antibiotics/polyketide fumonisin [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=26.22  E-value=27  Score=27.74  Aligned_cols=44  Identities=16%  Similarity=0.360  Sum_probs=30.5

Q ss_pred             EEEEcCCCCEEEEEEEEeCCEEEecccHHHHHhHhCCCCCCEEEEEEe
Q 040084           45 AHITIPNGYVWQVKLKKEGRKVWFDDGWQDFVEAYSTFVGSLVLFEYE   92 (127)
Q Consensus        45 v~L~~~~G~~W~V~l~~~~~~~~~~~GW~~Fv~~~~L~~GD~lvF~~~   92 (127)
                      +++..|...+|.+...+.+++.|+.+-    +..-.|..||.++|.-.
T Consensus       165 at~vvPgSH~~~~~~~r~d~~~y~~~~----~~pv~lekGDallF~~~  208 (299)
T COG5285         165 ATLVVPGSHKWDVIPERPDHETYLERN----AVPVELEKGDALLFNGS  208 (299)
T ss_pred             ceEEEecccccccCCCCCCccchhhhc----ceeeeecCCCEEEEcch
Confidence            366667677787776555555565443    66778899999999654


No 57 
>TIGR02228 sigpep_I_arch signal peptidase I, archaeal type. This model represents signal peptidase I from most archaea, a subunit of the eukaryotic endoplasmic reticulum signal peptidase I complex, and an apparent signal peptidase I from a small number of bacteria. It is related to but does not overlap in hits with TIGR02227, the bacterial and mitochondrial signal peptidase I.
Probab=25.68  E-value=86  Score=22.29  Aligned_cols=16  Identities=13%  Similarity=0.235  Sum_probs=14.1

Q ss_pred             hCCCCCCEEEEEEecC
Q 040084           79 YSTFVGSLVLFEYESN   94 (127)
Q Consensus        79 ~~L~~GD~lvF~~~~~   94 (127)
                      ..++.||+++|+..++
T Consensus        59 ~~~~~GDIVvf~~~~~   74 (158)
T TIGR02228        59 NDIQVGDVITYKSPGF   74 (158)
T ss_pred             CCCCCCCEEEEEECCC
Confidence            5899999999998774


No 58 
>cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=25.64  E-value=84  Score=20.00  Aligned_cols=16  Identities=19%  Similarity=0.229  Sum_probs=13.0

Q ss_pred             ceEEEEcCCCCEEEEE
Q 040084           43 DVAHITIPNGYVWQVK   58 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~   58 (127)
                      ..+.++||+|+.|.+.
T Consensus       102 r~~~~~DPdGn~iei~  117 (120)
T cd09011         102 RVVRFYDPDKHIIEVG  117 (120)
T ss_pred             EEEEEECCCCCEEEEe
Confidence            4788899999988764


No 59 
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=25.51  E-value=77  Score=20.16  Aligned_cols=15  Identities=20%  Similarity=0.246  Sum_probs=12.8

Q ss_pred             eEEEEcCCCCEEEEE
Q 040084           44 VAHITIPNGYVWQVK   58 (127)
Q Consensus        44 ~v~L~~~~G~~W~V~   58 (127)
                      .+.+.||+|+.|++.
T Consensus       108 ~~~~~DPdG~~ie~~  122 (123)
T cd07262         108 AAYVRDPDGNKIEAV  122 (123)
T ss_pred             EEEEECCCCCEEEEe
Confidence            478999999999874


No 60 
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=25.48  E-value=91  Score=19.65  Aligned_cols=17  Identities=18%  Similarity=0.321  Sum_probs=13.8

Q ss_pred             ceEEEEcCCCCEEEEEE
Q 040084           43 DVAHITIPNGYVWQVKL   59 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~l   59 (127)
                      ..+.++||+|+.|++..
T Consensus       108 ~~~~~~DPdG~~iE~~~  124 (125)
T cd08357         108 ETFFLKDPSGNALEFKA  124 (125)
T ss_pred             eEEEEECCCCCEEEEee
Confidence            45889999999998763


No 61 
>cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins. BLMT is a bleomycin (Bm) resistance protein, encoded by the ble gene on the transposon Tn5. This protein confers a survival advantage to Escherichia coli host cells. Bm is a glycopeptide antibiotic produced naturally by actinomycetes. It is a potent anti-cancer drug, which acts as a strong DNA-cutting agent, thereby causing cell death. BLMT has strong binding affinity to Bm and it protects against this lethal compound through drug sequestering. BLMT has two identically-folded subdomains, with the same alpha/beta fold; these two halves have no sequence similarity. BLMT is a dimer with two Bm-binding pockets formed at the dimer interface.
Probab=25.37  E-value=77  Score=20.26  Aligned_cols=16  Identities=13%  Similarity=0.216  Sum_probs=13.4

Q ss_pred             ceEEEEcCCCCEEEEE
Q 040084           43 DVAHITIPNGYVWQVK   58 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~   58 (127)
                      ..+.++||+|+.|.+.
T Consensus       102 ~~~~~~DPdG~~ie~~  117 (120)
T cd08350         102 REFALVDPDGNLLRFG  117 (120)
T ss_pred             eEEEEECCCCCEEEee
Confidence            4689999999999873


No 62 
>cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase. This subfamily contains the N-terminal, non-catalytic, domain of THT oxygenase. THT oxygenase is an extradiol dioxygenase in the 2,4-dinitrotoluene (DNT) degradation pathway. It catalyzes the conversion of 2,4,5-trihydroxytoluene to an unstable ring fission product, 2,4-dihydroxy-5-methyl-6-oxo-2,4-hexadienoic acid. The native protein was determined to be a dimer by gel filtration. The enzyme belongs to the type I family of extradiol dioxygenases which contains two structurally homologous barrel-shaped domains at the N- and C-terminus of each monomer. The active-site metal is located in the C-terminal barrel. Fe(II) is required for its catalytic activity.
Probab=25.12  E-value=1e+02  Score=19.54  Aligned_cols=18  Identities=17%  Similarity=0.327  Sum_probs=14.8

Q ss_pred             ceEEEEcCCCCEEEEEEE
Q 040084           43 DVAHITIPNGYVWQVKLK   60 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~l~   60 (127)
                      ..+.+.||+|+.|++...
T Consensus        93 ~~~~~~DPdG~~iEl~~~  110 (113)
T cd07267          93 KRVTLTDPDGFPVELVYG  110 (113)
T ss_pred             eEEEEECCCCCEEEEEec
Confidence            468899999999988763


No 63 
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of Burkholderia sp. NF100 MhqB and similar proteins. MhqB is a type I extradiol dioxygenase involved in the catabolism of methylhydroquinone, an intermediate in the degradation of fenitrothion. The purified enzyme has shown extradiol ring cleavage activity toward 3-methylcatechol. Fe2+ was suggested as a cofactor, the same as most other enzymes in the family. Burkholderia sp. NF100 MhqB is encoded on the plasmid pNF1. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=25.09  E-value=84  Score=19.83  Aligned_cols=17  Identities=35%  Similarity=0.489  Sum_probs=14.3

Q ss_pred             ceEEEEcCCCCEEEEEE
Q 040084           43 DVAHITIPNGYVWQVKL   59 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~l   59 (127)
                      ..+.+.||+|+.|.+..
T Consensus        92 ~~~~~~DP~Gn~iel~~  108 (112)
T cd08344          92 DGVWFRDPDGNLLQVKV  108 (112)
T ss_pred             CEEEEECCCCCEEEEec
Confidence            36899999999998874


No 64 
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=24.94  E-value=85  Score=19.62  Aligned_cols=16  Identities=19%  Similarity=0.005  Sum_probs=12.9

Q ss_pred             ceEEEEcCCCCEEEEE
Q 040084           43 DVAHITIPNGYVWQVK   58 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~   58 (127)
                      ..+.++||+|+.|.+-
T Consensus        98 ~~~~~~DPdGn~ie~~  113 (114)
T cd07261          98 YTFVALDPDGHRLRVF  113 (114)
T ss_pred             cEEEEECCCCCEEEee
Confidence            4578999999998873


No 65 
>cd08777 Death_RIP1 Death Domain of Receptor-Interacting Protein 1. Death domain (DD) found in Receptor-Interacting Protein 1 (RIP1) and related proteins. RIP kinases serve as essential sensors of cellular stress. Vertebrates contain several types containing a homologous N-terminal kinase domain and varying C-terminal domains. RIP1 harbors a C-terminal DD, which binds death receptors (DRs) including TNF receptor 1, Fas, TNF-related apoptosis-inducing ligand receptor 1 (TRAILR1), and TRAILR2. It also interacts with other DD-containing adaptor proteins such as TRADD and FADD. RIP1 plays a crucial role in determining a cell's fate, between survival or death, following exposure to stress signals. It is important in the signaling of NF-kappaB and MAPKs, and it links DR-associated signaling to reactive oxygen species (ROS) production. Abnormal RIP1 function may result in ROS accumulation affecting inflammatory responses, innate immunity, stress responses, and cell survival. In general, DDs ar
Probab=24.74  E-value=18  Score=23.18  Aligned_cols=23  Identities=4%  Similarity=0.186  Sum_probs=19.1

Q ss_pred             ecccHHHHHhHhCCCCCCEEEEE
Q 040084           68 FDDGWQDFVEAYSTFVGSLVLFE   90 (127)
Q Consensus        68 ~~~GW~~Fv~~~~L~~GD~lvF~   90 (127)
                      ++..|++|+..-++.+.|+=.|+
T Consensus        12 lG~~Wk~lar~LG~s~~eI~~ie   34 (86)
T cd08777          12 LGKKWKRCARKLGFTESEIEEID   34 (86)
T ss_pred             HHHHHHHHHHHcCCCHHHHHHHH
Confidence            57899999999999998765554


No 66 
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase. This subfamily contains the N-terminal, non-catalytic, domain of catechol 2,3-dioxygenase. Catechol 2,3-dioxygenase  (2,3-CTD, catechol:oxygen 2,3-oxidoreductase) catalyzes an extradiol cleavage of catechol to form 2-hydroxymuconate semialdehyde with the insertion of two atoms of oxygen. The enzyme is a homotetramer and contains catalytically essential Fe(II) . The reaction proceeds by an ordered bi-unit mechanism. First, catechol binds to the enzyme, this is then followed by the binding of dioxygen to form a tertiary complex, and then the aromatic ring is cleaved to produce 2-hydroxymuconate semialdehyde. Catechol 2,3-dioxygenase belongs to the type I extradiol dioxygenase family. The subunit comprises the N- and C-terminal domains of similar structure fold, resulting from an ancient gene duplication. The active site is located in a funnel-shaped space of the C-terminal domain. This subfamily represents the N-terminal do
Probab=24.68  E-value=1.1e+02  Score=19.39  Aligned_cols=18  Identities=11%  Similarity=0.276  Sum_probs=15.0

Q ss_pred             ceEEEEcCCCCEEEEEEE
Q 040084           43 DVAHITIPNGYVWQVKLK   60 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~l~   60 (127)
                      ..+.++||+|+.|++...
T Consensus       102 ~~~~~~DPdG~~iE~~~~  119 (122)
T cd07265         102 RRVRFQLPSGHTMELYAD  119 (122)
T ss_pred             eEEEEECCCCCEEEEEEe
Confidence            468999999999988764


No 67 
>PRK03760 hypothetical protein; Provisional
Probab=24.33  E-value=81  Score=21.30  Aligned_cols=21  Identities=14%  Similarity=0.006  Sum_probs=17.1

Q ss_pred             ecccHHHHHhHhCCCCCCEEEEEE
Q 040084           68 FDDGWQDFVEAYSTFVGSLVLFEY   91 (127)
Q Consensus        68 ~~~GW~~Fv~~~~L~~GD~lvF~~   91 (127)
                      +..||   +..++|+.||.+.|+.
T Consensus        96 l~aG~---~~~~gi~~Gd~v~~~~  116 (117)
T PRK03760         96 GPVGK---IRVLKVEVGDEIEWID  116 (117)
T ss_pred             eCCCh---HHHcCCCCCCEEEEee
Confidence            46776   5789999999998864


No 68 
>PF14186 Aida_C2:  Cytoskeletal adhesion; PDB: 2QZQ_A 2QZ5_A.
Probab=23.90  E-value=63  Score=22.99  Aligned_cols=49  Identities=18%  Similarity=0.201  Sum_probs=31.4

Q ss_pred             eEEEEcCCCCE------EEEEEEEeCCEEEecccHHHHHhHhCCCCCCEEEEEEe
Q 040084           44 VAHITIPNGYV------WQVKLKKEGRKVWFDDGWQDFVEAYSTFVGSLVLFEYE   92 (127)
Q Consensus        44 ~v~L~~~~G~~------W~V~l~~~~~~~~~~~GW~~Fv~~~~L~~GD~lvF~~~   92 (127)
                      +|.+.|.+|+-      -.|...+.++.++|..+|.-=.--.+|..|-.++||+.
T Consensus        36 tVSV~D~~G~~ve~~QdTpv~~~~~~~yv~f~~~v~lqtple~lp~Gaai~fE~k   90 (147)
T PF14186_consen   36 TVSVKDGNGKDVEPPQDTPVGSRREDNYVHFNNTVHLQTPLEKLPKGAAIFFEFK   90 (147)
T ss_dssp             EEEEE-TTS-BSS--EE--S-SEEETTEEEEEEEEE-SS-GGGS-TT-EEEEEEE
T ss_pred             EEEEECCCCCCccccccCCCcccccCCEEEEcccEEEcCCHHHCCCceEEEEEEE
Confidence            67777877742      34444456788899999977777788999999999887


No 69 
>PF02972 Phycoerythr_ab:  Phycoerythrin, alpha/beta chain;  InterPro: IPR004228 Cryptophytes are unicellular photosynthetic algae that use a lumenally located light-harvesting system, which is distinct from the phycobilisome structure found in cyanobacteria and red algae. One of the key components of this system is water-soluble phycoerythrin (PE) 545 whose expression is enhanced by low light levels []. Phycoerythrin (PE) 545 is a heterodimeric of alpha(1)alpha(2)betabeta subunits. Each alpha subunit carries a covalently linked 15,16-dihydrobiliverdin chromophore that probably acts as the final energy acceptor. The architecture of the heterodimer suggests that PE 545 may dock to an acceptor protein via a deep cleft and that energy may be transferred via this intermediary protein to the reaction centre [].; GO: 0030089 phycobilisome; PDB: 1XG0_B 1QGW_B 1XF6_B.
Probab=23.89  E-value=37  Score=20.20  Aligned_cols=12  Identities=25%  Similarity=0.659  Sum_probs=8.2

Q ss_pred             EEEEECCCCeEE
Q 040084           98 QAHIYDETACEI  109 (127)
Q Consensus        98 ~V~If~~~~ce~  109 (127)
                      .|.|||.-||++
T Consensus         4 vItiFDhRGC~r   15 (57)
T PF02972_consen    4 VITIFDHRGCDR   15 (57)
T ss_dssp             EEEEEE-TT-SS
T ss_pred             EEEEecccccCC
Confidence            478999999965


No 70 
>cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The structures of this family demonstrate  domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins.
Probab=23.45  E-value=89  Score=19.64  Aligned_cols=15  Identities=20%  Similarity=0.295  Sum_probs=12.5

Q ss_pred             ceEEEEcCCCCEEEE
Q 040084           43 DVAHITIPNGYVWQV   57 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V   57 (127)
                      ..+.++||+|+.|.+
T Consensus       103 ~~~~~~DP~G~~ie~  117 (119)
T cd08359         103 RHFIVRDPNGVLIDI  117 (119)
T ss_pred             eEEEEECCCCCEEEE
Confidence            467889999999876


No 71 
>cd02786 MopB_CT_3 The MopB_CT_3 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=23.06  E-value=2.1e+02  Score=18.27  Aligned_cols=47  Identities=17%  Similarity=0.120  Sum_probs=35.1

Q ss_pred             CceeccHHHHHhcccCCCceEEEEcCCCCEEEEEEEEe----CCEEEecccH
Q 040084           25 QKPRIPNKIVRKFSHELSDVAHITIPNGYVWQVKLKKE----GRKVWFDDGW   72 (127)
Q Consensus        25 ~~L~IP~~F~~~~~~~~~~~v~L~~~~G~~W~V~l~~~----~~~~~~~~GW   72 (127)
                      ..+.|.+.=+++++-+..+.|.|.++.|+. .+.+...    .+.+++..||
T Consensus        31 ~~v~i~p~dA~~lgi~~Gd~V~v~s~~G~~-~~~v~~~~~i~~g~v~~~~g~   81 (116)
T cd02786          31 PTLLIHPADAAARGIADGDLVVVFNDRGSV-TLRAKVTDDVPPGVVVAEGGW   81 (116)
T ss_pred             CEEEECHHHHHHcCCCCCCEEEEEcCCeEE-EEEEEECCCCCCCEEEeeccc
Confidence            346788888888888888999999988864 3444432    4778888886


No 72 
>cd06530 S26_SPase_I The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3.4.21.89) family members are essential membrane-bound serine proteases that function to cleave the amino-terminal signal peptide extension from proteins that are translocated across biological membranes. The bacterial signal peptidase I, which is the most intensively studied, has two N-terminal transmembrane segments inserted in the plasma membrane and a hydrophilic, C-terminal catalytic region that is located in the periplasmic space. Although the bacterial signal peptidase I is monomeric, signal peptidases of eukaryotic cells commonly function as oligomeric complexes containing two divergent copies of the catalytic monomer. These are the IMP1 and IMP2 signal peptidases of the mitochondrial inner membrane that remove leader peptides from nuclear- and mitochondrial-encoded proteins. Also, two components of the endoplasmic reticulum signal peptidase in mammals (18-kDa and 21-kDa
Probab=22.84  E-value=1e+02  Score=18.65  Aligned_cols=16  Identities=19%  Similarity=0.328  Sum_probs=13.9

Q ss_pred             hCCCCCCEEEEEEecC
Q 040084           79 YSTFVGSLVLFEYESN   94 (127)
Q Consensus        79 ~~L~~GD~lvF~~~~~   94 (127)
                      ..++.||+++|+..+.
T Consensus        30 ~~~~~GDiv~~~~~~~   45 (85)
T cd06530          30 REPKRGDVVVFKSPGD   45 (85)
T ss_pred             CCCCCCCEEEEeCCCC
Confidence            5688999999999984


No 73 
>TIGR02480 fliN flagellar motor switch protein FliN. Proteins that consist largely of the domain described by this model can be designated flagellar motor switch protein FliN. Longer proteins in which this region is a C-terminal domain typically are designated FliY. More distantly related sequences, outside the scope of this family, are associated with type III secretion and include the surface presentation of antigens protein SpaO required or invasion of host cells by Salmonella enterica.
Probab=22.68  E-value=86  Score=19.28  Aligned_cols=22  Identities=9%  Similarity=0.069  Sum_probs=14.8

Q ss_pred             HHhHhCCCCCCEEEEEEecCcE
Q 040084           75 FVEAYSTFVGSLVLFEYESNST   96 (127)
Q Consensus        75 Fv~~~~L~~GD~lvF~~~~~~~   96 (127)
                      +..--+|++||++.+...-+..
T Consensus        23 l~ell~L~~Gdvi~L~~~~~~~   44 (77)
T TIGR02480        23 LGDLLKLGEGSVIELDKLAGEP   44 (77)
T ss_pred             HHHHhcCCCCCEEEcCCCCCCc
Confidence            3445678999999887543333


No 74 
>COG3400 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.25  E-value=2.4e+02  Score=23.50  Aligned_cols=44  Identities=14%  Similarity=0.268  Sum_probs=32.7

Q ss_pred             CCCceEEEEcCCC-------------CEEEEEEEEeCCEEEecccHHHHHhHhCCCCCCEEEE
Q 040084           40 ELSDVAHITIPNG-------------YVWQVKLKKEGRKVWFDDGWQDFVEAYSTFVGSLVLF   89 (127)
Q Consensus        40 ~~~~~v~L~~~~G-------------~~W~V~l~~~~~~~~~~~GW~~Fv~~~~L~~GD~lvF   89 (127)
                      +.++.+.+..|.|             +.|+|.+..++++++|..      ...-|+.||.++-
T Consensus       149 gkGEImEI~vp~gSifaYrhi~sI~qk~~RIvl~YRN~klll~~------~slvlqp~D~lLV  205 (471)
T COG3400         149 GKGEIMEIDVPFGSIFAYRHIGSIRQKEYRIVLLYRNDKLLLST------KSLVLQPRDILLV  205 (471)
T ss_pred             ccceEEEEecCCCchhhhhhhhhhhhheeEEEEEEECCEEEEec------cceEecCCCEEEE
Confidence            3456666666666             789999999999999876      3345788888753


No 75 
>PRK00809 hypothetical protein; Provisional
Probab=21.94  E-value=1.5e+02  Score=20.70  Aligned_cols=26  Identities=8%  Similarity=0.111  Sum_probs=21.5

Q ss_pred             EEecccHHHHHhHhCCCCCCEEEEEEec
Q 040084           66 VWFDDGWQDFVEAYSTFVGSLVLFEYES   93 (127)
Q Consensus        66 ~~~~~GW~~Fv~~~~L~~GD~lvF~~~~   93 (127)
                      .-+..|=+.|.++  ++.||.++|.+.+
T Consensus        22 ~g~~~~~rn~lr~--Mk~GD~v~fYhs~   47 (144)
T PRK00809         22 WGVPERYKNTIEK--VKPGDKLIIYVSQ   47 (144)
T ss_pred             eecchhhhhHHhh--CCCCCEEEEEECC
Confidence            3457777788887  9999999999987


No 76 
>PF14191 YodL:  YodL-like
Probab=21.83  E-value=88  Score=20.81  Aligned_cols=34  Identities=21%  Similarity=0.161  Sum_probs=26.7

Q ss_pred             EEEecccHHHHHhHh-------CCCCCCEEEEEEecCcEEE
Q 040084           65 KVWFDDGWQDFVEAY-------STFVGSLVLFEYESNSTFQ   98 (127)
Q Consensus        65 ~~~~~~GW~~Fv~~~-------~L~~GD~lvF~~~~~~~F~   98 (127)
                      .-.|..=|.+|-.++       .|..+|+++..-.+.+.|.
T Consensus        49 ~~~Le~iy~~FN~~~P~df~GhsLSvSDVV~l~~~g~~~~y   89 (103)
T PF14191_consen   49 TETLEDIYERFNVDHPEDFKGHSLSVSDVVELYDGGKSSFY   89 (103)
T ss_pred             CCCHHHHHHHhCcCCCCCCCCCccChheEEEEEcCCceEEE
Confidence            344777788888866       9999999999988866543


No 77 
>cd08315 Death_TRAILR_DR4_DR5 Death domain of Tumor necrosis factor-Related Apoptosis-Inducing Ligand Receptors. Death Domain (DD) found in Tumor necrosis factor-Related Apoptosis-Inducing Ligand (TRAIL) Receptors. In mammals, this family includes TRAILR1 (also called DR4 or TNFRSF10A) and TRAILR2 (also called DR5, TNFRSF10B, or KILLER). They function as receptors for the cytokine TRAIL and are involved in apoptosis signaling pathways. TRAIL preferentially induces apoptosis in cancer cells while exhibiting little toxicity in normal cells. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=21.79  E-value=32  Score=22.43  Aligned_cols=17  Identities=12%  Similarity=0.419  Sum_probs=14.9

Q ss_pred             ccHHHHHhHhCCCCCCE
Q 040084           70 DGWQDFVEAYSTFVGSL   86 (127)
Q Consensus        70 ~GW~~Fv~~~~L~~GD~   86 (127)
                      ..|++|+...+|.++|+
T Consensus        20 ~~Wk~laR~LGLse~~I   36 (96)
T cd08315          20 DSWNRLMRQLGLSENEI   36 (96)
T ss_pred             HHHHHHHHHcCCCHHHH
Confidence            57999999999998864


No 78 
>PF06052 3-HAO:  3-hydroxyanthranilic acid dioxygenase;  InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1.13.11.6 from EC). It is part of the kynurenine pathway for the degradation of tryptophan and the biosynthesis of nicotinic acid [].The prokaryotic homologue is involved in the 2-nitrobenzoate degradation pathway []. The enzyme acts on the tryptophan metabolite 3-hydroxyanthranilate and produces 2-amino-3-carboxymuconate semialdehyde, which can rearrange spontaneously to quinolinic acid and feed into nicotinamide biosynthesis, or undergo further enzymatic degradation.; GO: 0000334 3-hydroxyanthranilate 3,4-dioxygenase activity, 0005506 iron ion binding, 0008152 metabolic process, 0055114 oxidation-reduction process; PDB: 1ZVF_A 1YFX_A 1YFW_A 1YFY_A 1YFU_A 2QNK_A 3FE5_A.
Probab=21.67  E-value=64  Score=23.10  Aligned_cols=25  Identities=4%  Similarity=0.113  Sum_probs=18.6

Q ss_pred             HhHhCCCCCCEEEEEEecCcEEEEE
Q 040084           76 VEAYSTFVGSLVLFEYESNSTFQAH  100 (127)
Q Consensus        76 v~~~~L~~GD~lvF~~~~~~~F~V~  100 (127)
                      .+||++.+|+-+.+++.|++.++|.
T Consensus        45 R~DyHine~eE~FyQ~kG~m~Lkv~   69 (151)
T PF06052_consen   45 RTDYHINETEEFFYQLKGDMCLKVV   69 (151)
T ss_dssp             -SSEEE-SS-EEEEEEES-EEEEEE
T ss_pred             CCccccCCcceEEEEEeCcEEEEEE
Confidence            4688899999999999999988855


No 79 
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=21.54  E-value=1e+02  Score=19.31  Aligned_cols=17  Identities=12%  Similarity=0.235  Sum_probs=13.7

Q ss_pred             CceEEEEcCCCCEEEEE
Q 040084           42 SDVAHITIPNGYVWQVK   58 (127)
Q Consensus        42 ~~~v~L~~~~G~~W~V~   58 (127)
                      ...+.+.||+|..|++.
T Consensus       104 ~~~~~~~DP~G~~ie~~  120 (122)
T cd08354         104 GRSLYFRDPDGNLLELA  120 (122)
T ss_pred             eeEEEEECCCCCEEEEe
Confidence            35788999999988874


No 80 
>COG3607 Predicted lactoylglutathione lyase [General function prediction only]
Probab=21.15  E-value=1.1e+02  Score=21.47  Aligned_cols=17  Identities=24%  Similarity=0.442  Sum_probs=14.0

Q ss_pred             eEEEEcCCCCEEEEEEE
Q 040084           44 VAHITIPNGYVWQVKLK   60 (127)
Q Consensus        44 ~v~L~~~~G~~W~V~l~   60 (127)
                      -...+||+|..|++.+.
T Consensus       111 g~~fqDpDGh~wE~l~m  127 (133)
T COG3607         111 GRSFQDPDGHVWEFLWM  127 (133)
T ss_pred             ceeeeCCCCCeEEEEEe
Confidence            35688999999998874


No 81 
>PF03221 HTH_Tnp_Tc5:  Tc5 transposase DNA-binding domain;  InterPro: IPR006600 This entry represents a DNA-binding helix-turn-helix domain found in the pogo family of transposable elements, the centromere protein Cenp-B, and yeast PCD2. There is extensive sequence similarity between Cenp-B and transposase proteins encoded by the pogo superfamily of transposable elements, which includes the human Tigger and Jerky elements []. The HTH domain is composed of three alpha-helices, with the second and third helices connected via a turn comprise the helix-turn-helix motif. Helix 3 is termed the recognition helix as it binds the DNA major groove, as in other HTHs []. This conserved DNA-binding domain is found in the following proteins:   Cenp-B (major centromere autoantigen B or centromere protein B), which appears to organise arrays of centromere satellite DNA into a higher order structure that then direct centromere formation and kinetochore assembly in mammalian chromosomes. The N terminus of Cenp-B contains two DNA-binding HTH domains, which bind to adjacent major grooves of DNA: a psq-type HTH domain followed by a CenpB-type HTH domain, which together bind specifically to the Cenp-B box, which occurs in alpha-satellite DNA in human centromeres [].      Pogo family transposable elements includes both Tigger and Jerky elements []. Pogo contains two open reading frames flanked by inverted repeats. The N-terminal region of pogo transposase contains a Cenp-B-type HTH DNA-binding domain []. Mammalian jerky protein, involved in epileptic seizures in mice [].     PDC2 (Pyruvate DeCarboxylase 2), which is a transcription factor required for the synthesis of the glycolytic enzyme pyruvate decarboxylase, required for high level expression of both the THI and the PDC genes. PDC2 may be important for a high basal level of PDC gene expression or play a positive role in the autoregulation control of PDC1 and PDC5 [, ].  ; PDB: 1HLV_A 1IUF_A.
Probab=20.81  E-value=58  Score=18.67  Aligned_cols=20  Identities=15%  Similarity=0.318  Sum_probs=10.7

Q ss_pred             CEEEecccH-HHHHhHhCCCC
Q 040084           64 RKVWFDDGW-QDFVEAYSTFV   83 (127)
Q Consensus        64 ~~~~~~~GW-~~Fv~~~~L~~   83 (127)
                      ....++.|| ..|.+.|+|..
T Consensus        44 ~~~~~s~~W~~~F~~Rh~i~~   64 (66)
T PF03221_consen   44 PEFKASKGWLDRFKKRHGIKL   64 (66)
T ss_dssp             TT-S--CHHHHHHHHHTS---
T ss_pred             CcCCcccHHHHHHHHHcCCCC
Confidence            345578999 55999998763


No 82 
>PRK06724 hypothetical protein; Provisional
Probab=20.78  E-value=1.3e+02  Score=20.04  Aligned_cols=17  Identities=24%  Similarity=0.417  Sum_probs=13.8

Q ss_pred             ceEEEEcCCCCEEEEEE
Q 040084           43 DVAHITIPNGYVWQVKL   59 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~l   59 (127)
                      ..+.++||+|+.|++..
T Consensus       106 ~~~~f~DPdG~~iEl~~  122 (128)
T PRK06724        106 YTIDFYDPNGFIIEVAY  122 (128)
T ss_pred             EEEEEECCCCCEEEEEe
Confidence            35678999999998865


No 83 
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1.13.11.39) 1 from Rhodococcus globerulus P6 (BphC1-RGP6) and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of BphC1-RGP6 and similar proteins. BphC catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). This subfamily of BphCs belongs to the type I extradiol dioxygenase family, which require a metal in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of 2,3-dihydroxybiphenyl 1,2-dioxygenases. For example, three types of BphC enzymes have been found in Rhodococcus globerulus (BphC1-RGP6 - BphC3-RGP6), all three enzymes are type I extradiol dioxygenases. BphC1-RGP6 has an internal duplication, it is a two-domain dioxygenase which forms octamers, and has Fe(II) at the catalytic site. Its N-
Probab=20.78  E-value=1.3e+02  Score=19.14  Aligned_cols=17  Identities=12%  Similarity=0.222  Sum_probs=14.5

Q ss_pred             ceEEEEcCCCCEEEEEE
Q 040084           43 DVAHITIPNGYVWQVKL   59 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~l   59 (127)
                      ..+.++||+|+.|++..
T Consensus       100 ~~~~~~DPdG~~iE~~~  116 (120)
T cd07252         100 GLIRFADPDGNRHELFW  116 (120)
T ss_pred             EEEEEECCCCCEEEEEe
Confidence            46899999999998876


No 84 
>PF11604 CusF_Ec:  Copper binding periplasmic protein CusF;  InterPro: IPR021647  CusF is a periplasmic protein involved in copper and silver resistance in Escherichia coil. CusF forms a five-stranded beta-barrel OB fold. Cu(I) binds to H36, M47 and M49 which are conserved residues in the protein []. ; PDB: 2L55_A 2VB3_X 1ZEQ_X 2QCP_X 3E6Z_X 2VB2_X.
Probab=20.66  E-value=1.8e+02  Score=17.50  Aligned_cols=24  Identities=17%  Similarity=0.252  Sum_probs=15.7

Q ss_pred             HhCCCCCCEEEEEEec--CcEEEEEE
Q 040084           78 AYSTFVGSLVLFEYES--NSTFQAHI  101 (127)
Q Consensus        78 ~~~L~~GD~lvF~~~~--~~~F~V~I  101 (127)
                      -.+|+.||.+.|.+..  +..+.|.-
T Consensus        40 l~~l~~Gd~V~F~~~~~~~~~~~I~~   65 (70)
T PF11604_consen   40 LAGLKPGDKVRFTFERTDDGSYVITA   65 (70)
T ss_dssp             ESS-STT-EEEEEEEEETTCEEEEEE
T ss_pred             hhcCCCCCEEEEEEEECCCCcEEEEE
Confidence            3578999999999986  23366553


No 85 
>cd00175 SNc Staphylococcal nuclease homologues. SNase homologues are found in bacteria, archaea, and eukaryotes. They contain no disufide bonds.
Probab=20.60  E-value=1.9e+02  Score=18.94  Aligned_cols=33  Identities=12%  Similarity=0.137  Sum_probs=27.5

Q ss_pred             CCCCCEEEEEEecCcEEEEEEECCCCeEEecCC
Q 040084           81 TFVGSLVLFEYESNSTFQAHIYDETACEINYPS  113 (127)
Q Consensus        81 L~~GD~lvF~~~~~~~F~V~If~~~~ce~~~~~  113 (127)
                      +..||.+.+...+.....|.+.+-+..|...++
T Consensus         2 V~dGDt~~v~~~~~~~~~vrL~gId~Pe~~~~~   34 (129)
T cd00175           2 VIDGDTIRVRLPPGPLITVRLSGIDAPETARPN   34 (129)
T ss_pred             eecCcEEEEEeCCCCEEEEEEEeecCccccCCc
Confidence            457999999888777889999998888887665


No 86 
>cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=20.52  E-value=1.3e+02  Score=18.68  Aligned_cols=17  Identities=24%  Similarity=0.497  Sum_probs=13.8

Q ss_pred             ceEEEEcCCCCEEEEEE
Q 040084           43 DVAHITIPNGYVWQVKL   59 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V~l   59 (127)
                      ..+.+.||+|+.|.+..
T Consensus       104 ~~~~~~DP~Gn~iei~~  120 (121)
T cd07251         104 YSGYFADPDGHLWEVAH  120 (121)
T ss_pred             eEEEEECCCCCEEEEee
Confidence            46889999999998754


No 87 
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC). This subfamily contains the N-terminal, non-catalytic, domain of PpCmtC. 2,3-dihydroxy-p-cumate-3,4-dioxygenase (CmtC of Pseudomonas putida F1) is a dioxygenase involved in the eight-step catabolism pathway of p-cymene. CmtC acts upon the reaction intermediate 2,3-dihydroxy-p-cumate, yielding 2-hydroxy-3-carboxy-6-oxo-7-methylocta-2,4-dienoate. The CmtC belongs to the type I family of extradiol dioxygenases. Fe2+ was suggested as a cofactor, same as other enzymes in the family. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=20.34  E-value=1.4e+02  Score=19.36  Aligned_cols=17  Identities=12%  Similarity=0.251  Sum_probs=14.2

Q ss_pred             eEEEEcCCCCEEEEEEE
Q 040084           44 VAHITIPNGYVWQVKLK   60 (127)
Q Consensus        44 ~v~L~~~~G~~W~V~l~   60 (127)
                      .+.+.||+|+.|++...
T Consensus       103 ~~~f~DPdG~~iE~~~~  119 (124)
T cd08361         103 FIAFRDPSGNSIELVVR  119 (124)
T ss_pred             EEEEECcCCCEEEEEEe
Confidence            47899999999988653


No 88 
>PF02643 DUF192:  Uncharacterized ACR, COG1430;  InterPro: IPR003795 This entry describes proteins of unknown function.; PDB: 3M7A_B 3PJY_B.
Probab=20.30  E-value=76  Score=20.89  Aligned_cols=20  Identities=35%  Similarity=0.596  Sum_probs=11.4

Q ss_pred             ecccHHHHHhHhCCCCCCEEEEE
Q 040084           68 FDDGWQDFVEAYSTFVGSLVLFE   90 (127)
Q Consensus        68 ~~~GW~~Fv~~~~L~~GD~lvF~   90 (127)
                      +..||   +..++|+.||.+.|+
T Consensus        88 ~~aG~---~~~~~i~~Gd~v~~~  107 (108)
T PF02643_consen   88 LPAGW---FEKLGIKVGDRVRIE  107 (108)
T ss_dssp             EETTH---HHHHT--TT-EEE--
T ss_pred             cCCCc---hhhcCCCCCCEEEec
Confidence            35554   678999999999875


No 89 
>PRK08433 flagellar motor switch protein; Validated
Probab=20.07  E-value=1.1e+02  Score=20.69  Aligned_cols=27  Identities=15%  Similarity=0.171  Sum_probs=17.5

Q ss_pred             HHHhHhCCCCCCEEEEEEecCcEEEEE
Q 040084           74 DFVEAYSTFVGSLVLFEYESNSTFQAH  100 (127)
Q Consensus        74 ~Fv~~~~L~~GD~lvF~~~~~~~F~V~  100 (127)
                      .+..--+|++||++.+...-+....|.
T Consensus        46 tl~dlL~Lq~GDVI~Ld~~~~e~v~v~   72 (111)
T PRK08433         46 SLLEILKFEKGSVIDLEKPAGESVELY   72 (111)
T ss_pred             cHHHHhCCCCCCEEEeCCCCCCCEEEE
Confidence            345567899999999876543333333


No 90 
>cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains. SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a strep
Probab=20.07  E-value=1.2e+02  Score=18.93  Aligned_cols=15  Identities=27%  Similarity=0.417  Sum_probs=12.0

Q ss_pred             ceEEEEcCCCCEEEE
Q 040084           43 DVAHITIPNGYVWQV   57 (127)
Q Consensus        43 ~~v~L~~~~G~~W~V   57 (127)
                      ..+.+.||+|+.|.+
T Consensus        98 ~~~~~~DPdG~~~~l  112 (114)
T cd07247          98 RFAVFADPEGAVFGL  112 (114)
T ss_pred             EEEEEECCCCCEEEe
Confidence            467888899988876


Done!