Query         040093
Match_columns 48
No_of_seqs    54 out of 56
Neff          3.5 
Searched_HMMs 46136
Date          Fri Mar 29 05:03:45 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/040093.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/040093hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4267 Predicted membrane pro  99.4 2.9E-13 6.4E-18   85.3   4.0   36    2-37     75-110 (110)
  2 PF03647 Tmemb_14:  Transmembra  98.5 9.3E-08   2E-12   57.2   2.1   26    2-27     71-96  (96)
  3 PF06103 DUF948:  Bacterial pro  42.1      48   0.001   18.6   3.2   20   11-30      2-21  (90)
  4 cd04411 Ribosomal_P1_P2_L12p R  41.7      19 0.00042   22.0   1.6   15   21-35      1-16  (105)
  5 PF05283 MGC-24:  Multi-glycosy  41.1      32  0.0007   23.2   2.7   21   11-31    165-185 (186)
  6 PLN02356 phosphateglycerate ki  40.9      41 0.00089   24.9   3.4   25   10-34      7-31  (423)
  7 PF04588 HIG_1_N:  Hypoxia indu  40.8      53  0.0011   17.5   3.1   25    4-28      2-26  (54)
  8 PF06522 B12D:  NADH-ubiquinone  37.3      62  0.0013   18.3   3.1   24    7-30      5-28  (73)
  9 COG4858 Uncharacterized membra  36.8      26 0.00056   24.8   1.7   14   11-24    105-118 (226)
 10 PTZ00233 variable surface prot  35.8      27 0.00059   26.9   1.9   31    9-41    440-470 (509)
 11 COG5548 Small integral membran  35.2      28 0.00061   22.1   1.6   25    2-28     74-98  (105)
 12 PF09777 OSTMP1:  Osteopetrosis  35.0      59  0.0013   22.1   3.2   20   19-38    201-220 (237)
 13 PTZ00234 variable surface prot  32.8      34 0.00074   25.6   1.9   27   14-41    371-400 (433)
 14 PF10661 EssA:  WXG100 protein   32.5      65  0.0014   20.6   2.9   26    6-31    115-141 (145)
 15 PF10206 WRW:  Mitochondrial F1  31.6      58  0.0012   20.3   2.5   19   11-29     77-95  (104)
 16 PF07423 DUF1510:  Protein of u  31.2      61  0.0013   22.2   2.8   34    5-40     12-45  (217)
 17 PF13197 DUF4013:  Protein of u  28.5   1E+02  0.0022   18.9   3.3   26   13-38      9-39  (169)
 18 PF12273 RCR:  Chitin synthesis  24.7 1.1E+02  0.0024   18.4   2.9   16   12-27      7-22  (130)
 19 PRK11235 bifunctional antitoxi  24.5 1.1E+02  0.0023   18.0   2.7   22   17-38     27-48  (80)
 20 PF14019 DUF4235:  Protein of u  24.3 1.5E+02  0.0032   16.9   4.4   25   13-38     10-34  (78)
 21 PF11337 DUF3139:  Protein of u  24.2      84  0.0018   17.8   2.2   19   23-41     18-36  (85)
 22 PF12270 Cyt_c_ox_IV:  Cytochro  24.1 2.1E+02  0.0046   18.5   4.2   33    9-41     34-70  (137)
 23 PF04678 DUF607:  Protein of un  23.6 1.4E+02   0.003   19.2   3.3   24   16-39    129-152 (180)
 24 PF02468 PsbN:  Photosystem II   23.5 1.4E+02  0.0029   16.1   3.2   28   16-43     10-37  (43)
 25 cd07468 CRD_TK_ROR2 Cysteine-r  23.0      47   0.001   21.6   1.0   22   18-39     58-81  (140)
 26 PF02439 Adeno_E3_CR2:  Adenovi  22.9 1.3E+02  0.0029   15.8   2.8   18   11-28     10-27  (38)
 27 TIGR03685 L21P_arch 50S riboso  22.8      63  0.0014   19.7   1.6   15   21-35      1-16  (105)
 28 PRK12573 putative monovalent c  22.1 2.1E+02  0.0047   18.1   3.9   26   11-36      9-34  (140)
 29 PF06939 DUF1286:  Protein of u  21.5 1.2E+02  0.0026   19.4   2.7   24    2-25      2-26  (114)
 30 PF06679 DUF1180:  Protein of u  21.4 1.4E+02  0.0031   19.7   3.1   26   13-38    100-125 (163)
 31 PRK13183 psbN photosystem II r  21.1 1.3E+02  0.0028   16.5   2.4   28   16-43     13-40  (46)
 32 KOG4697 Integral membrane prot  21.1 1.2E+02  0.0025   20.5   2.7   27   14-40     25-51  (160)

No 1  
>KOG4267 consensus Predicted membrane protein [Function unknown]
Probab=99.40  E-value=2.9e-13  Score=85.27  Aligned_cols=36  Identities=53%  Similarity=1.103  Sum_probs=34.9

Q ss_pred             cccccccchhHHHHHHHHHHHHHHHHHHhcCCCCCC
Q 040093            2 WMQTKKLFPTGFYAAISAAMLCFYSYVVASGGNPPP   37 (48)
Q Consensus         2 y~~T~kifPaG~va~iS~~M~~FY~y~l~~ggNp~p   37 (48)
                      |+.|+|+||+|+++.+|++|+|||.|++++++||+|
T Consensus        75 ~~~s~K~mPaglva~~s~~m~~~Y~y~~~~~~~~~~  110 (110)
T KOG4267|consen   75 FYRSRKIMPAGLVAGISLLMTCFYLYVVLRGGNPPP  110 (110)
T ss_pred             hhccCCccchHHHHHHHHHHHHHHHHHHHhccCCCC
Confidence            789999999999999999999999999999999986


No 2  
>PF03647 Tmemb_14:  Transmembrane proteins 14C;  InterPro: IPR005349 This family of short membrane proteins is as yet uncharacterised.; GO: 0016020 membrane; PDB: 2LOS_A 2LOO_A 2LOP_A.
Probab=98.46  E-value=9.3e-08  Score=57.25  Aligned_cols=26  Identities=46%  Similarity=0.964  Sum_probs=23.4

Q ss_pred             cccccccchhHHHHHHHHHHHHHHHH
Q 040093            2 WMQTKKLFPTGFYAAISAAMLCFYSY   27 (48)
Q Consensus         2 y~~T~kifPaG~va~iS~~M~~FY~y   27 (48)
                      |.+|+|+||+|+++++|++|++||.|
T Consensus        71 ~~~t~k~~Pagl~~~~s~~~~~~y~Y   96 (96)
T PF03647_consen   71 YIKTRKFMPAGLMALLSGAMLAFYYY   96 (96)
T ss_dssp             S-SSSSSCCCHHHHHHHHHHHHHHC-
T ss_pred             HHHcCCCccHHHHHHHHHHHHHHhcC
Confidence            78999999999999999999999987


No 3  
>PF06103 DUF948:  Bacterial protein of unknown function (DUF948);  InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins.
Probab=42.10  E-value=48  Score=18.62  Aligned_cols=20  Identities=35%  Similarity=0.466  Sum_probs=16.8

Q ss_pred             hHHHHHHHHHHHHHHHHHHh
Q 040093           11 TGFYAAISAAMLCFYSYVVA   30 (48)
Q Consensus        11 aG~va~iS~~M~~FY~y~l~   30 (48)
                      +++++.++.+.++.|+-..+
T Consensus         2 a~lI~Aiaf~vLvi~l~~~l   21 (90)
T PF06103_consen    2 AGLIAAIAFAVLVIFLIKVL   21 (90)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            68899999999998887665


No 4  
>cd04411 Ribosomal_P1_P2_L12p Ribosomal protein P1, P2, and L12p. Ribosomal proteins P1 and P2 are the eukaryotic proteins that are functionally equivalent to bacterial L7/L12. L12p is the archaeal homolog. Unlike other ribosomal proteins, the archaeal L12p and eukaryotic P1 and P2 do not share sequence similarity with their bacterial counterparts. They are part of the ribosomal stalk (called the L7/L12 stalk in bacteria), along with 28S rRNA and the proteins L11 and P0 in eukaryotes (23S rRNA, L11, and L10e in archaea). In bacterial ribosomes, L7/L12 homodimers bind the extended C-terminal helix of L10 to anchor the L7/L12 molecules to the ribosome. Eukaryotic P1/P2 heterodimers and archaeal L12p homodimers are believed to bind the L10 equivalent proteins, eukaryotic P0 and archaeal L10e, in a similar fashion. P1 and P2 (L12p, L7/L12) are the only proteins in the ribosome to occur as multimers, always appearing as sets of dimers. Recent data indicate that most archaeal species contain 
Probab=41.73  E-value=19  Score=21.97  Aligned_cols=15  Identities=27%  Similarity=0.530  Sum_probs=12.1

Q ss_pred             HHHHHHHHHh-cCCCC
Q 040093           21 MLCFYSYVVA-SGGNP   35 (48)
Q Consensus        21 M~~FY~y~l~-~ggNp   35 (48)
                      |-|-|+|-|+ .+||.
T Consensus         1 m~~v~A~Lll~~~g~~   16 (105)
T cd04411           1 MEYVAAYLLLHKGGKE   16 (105)
T ss_pred             CHHHHHHHHHHhcCCC
Confidence            6789999999 66665


No 5  
>PF05283 MGC-24:  Multi-glycosylated core protein 24 (MGC-24);  InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor. Its functions include mediating, or regulating, haematopoietic progenitor cell adhesion and the negative regulation of their growth and/or-differentiation. It exists in the native state as a disulphide- linked homodimer of two 80-85kDa subunits. It is usually expressed by CD34+ and CD341o/- haematopoietic stem cells and associated microenvironmental cells. It contains, in its extracellular region, two mucin domains (I and II) linked by a non-mucin domain, which has been predicted to contain intra- disulphide bridges. This receptor may play a key role in haematopoiesis by facilitating the adhesion of human CD34+ cells to bone marrow stroma and by negatively regulating CD34+ CD341o/- haematopoietic progenitor cell proliferation. These effects involve the CD164 class I and/or II epitopes recognised by the monoclonal antibodies (mAbs) 105A5 and 103B2/9E10. These epitopes are carbohydrate-dependent and are located on the N-terminal mucin domain I [, ]. It has been found that murine MGC-24v and rat endolyn share significant sequence similarities with human CD164. However, CD164 lacks the consensus glycosaminoglycan (GAG)-attachment site found in MGC-24; it is possible that GAG-association is responsible for the high molecular weight of the epithelial-derived MGC-24 glycoprotein [].  Genomic structure studies have placed CD164 within the mucin-subgroup that comprises multiple exons, and demonstrate the diverse chromosomal distribution of this family of molecules. Molecules with such multiple exons may have sophisticated regulatory mechanisms that involve not only post-translational modifications of the oligosaccharide side chains, but also differential exon usage. Although differences in the intron and exon sizes are seen between the mouse and human genes, the predicted proteins are similar in size and structure, maintaining functionally important motifs that regulate cell proliferation or subcellular distribution [].  CD164 is a gene whose expression depends on differential usage of poly- adenylation sites within the 3'-UTR. The conserved distribution of the 3.2- and 1.2-kb CD164 transcripts between mouse and human suggests that (i) a mechanism may exist to regulate tissue-specific polyadenylation, and (ii) differences in polyadenylation are important for the expression and function of CD164 in different tissues. Two other aspects of the structure of CD164 are of particular interest. First, it shares one of several conserved features of a cytokine-binding pocket - in this respect, it is notable that evidence exists for a class of cell-surface sialomucin modulators that directly interact with growth factor receptors to regulate their response to physiological ligands. Second, its cytoplasmic tail contains a C-terminal YHTL motif found in many endocytic membrane proteins or receptors. These Tyr-based motifs bind to adaptor proteins, which mediate the sorting of membrane proteins into transport vesicles from the plasma membrane to the endosomes, and between intracellular compartments. 
Probab=41.12  E-value=32  Score=23.19  Aligned_cols=21  Identities=14%  Similarity=0.393  Sum_probs=18.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHhc
Q 040093           11 TGFYAAISAAMLCFYSYVVAS   31 (48)
Q Consensus        11 aG~va~iS~~M~~FY~y~l~~   31 (48)
                      -|||-.+++.-.+|++|+..+
T Consensus       165 GGIVL~LGv~aI~ff~~KF~k  185 (186)
T PF05283_consen  165 GGIVLTLGVLAIIFFLYKFCK  185 (186)
T ss_pred             hHHHHHHHHHHHHHHHhhhcc
Confidence            589999999999999999764


No 6  
>PLN02356 phosphateglycerate kinase
Probab=40.86  E-value=41  Score=24.92  Aligned_cols=25  Identities=28%  Similarity=0.356  Sum_probs=21.1

Q ss_pred             hhHHHHHHHHHHHHHHHHHHhcCCC
Q 040093           10 PTGFYAAISAAMLCFYSYVVASGGN   34 (48)
Q Consensus        10 PaG~va~iS~~M~~FY~y~l~~ggN   34 (48)
                      --.+++.-|++|++-|.+.+....+
T Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~   31 (423)
T PLN02356          7 TGAVVAAASLLMLLSYSFLLCNSRK   31 (423)
T ss_pred             hhHHHHHHHHHHHHHHHHHhhcccc
Confidence            3468899999999999999986655


No 7  
>PF04588 HIG_1_N:  Hypoxia induced protein conserved region;  InterPro: IPR007667 The hypoxia induced gene 1 (HIG1) or hypoglycemia/hypoxia inducible mitochondrial protein (HIMP1) is up-regulated by stresses of the microenvironment such as low oxygen or low glucose conditions. HIG1 is a mitochondrial inner membrane protein, which is ubiquitously expressed. It is predicted to be an integral membrane protein consisting of two hydrophobic helices, 21-23 residues in length that might tend to form a hairpin-like loop across the bilayer. HIG1 could be implied in apoptotic or cytoprotective signals. HIG1 is a member of a well conserved eukaryote protein family. The predicted transmembrane helice (TMH) and loop regions represent the most highly conserved regions in these proteins [, ]. The profile we developed covers the predicted TMH and loop regions. This domain is found in proteins thought to be involved in the response to hypoxia []. It is also found in altered inheritance of mitochondria proteins.; PDB: 2LOM_A 2LON_A.
Probab=40.84  E-value=53  Score=17.52  Aligned_cols=25  Identities=24%  Similarity=0.530  Sum_probs=17.2

Q ss_pred             cccccchhHHHHHHHHHHHHHHHHH
Q 040093            4 QTKKLFPTGFYAAISAAMLCFYSYV   28 (48)
Q Consensus         4 ~T~kifPaG~va~iS~~M~~FY~y~   28 (48)
                      +-+.++|-|..+...++....|.+.
T Consensus         2 ke~plv~ig~~~~~~~l~~g~~~~~   26 (54)
T PF04588_consen    2 KENPLVPIGMLATVGALAYGLYNFR   26 (54)
T ss_dssp             -S--CHHHHHHHHHHHHHHHHHHHT
T ss_pred             CcccHHHHHHHHHHHHHHHHHHHhc
Confidence            3467889999988888777766654


No 8  
>PF06522 B12D:  NADH-ubiquinone reductase complex 1 MLRQ subunit;  InterPro: IPR010530 The MLRQ subunit of mitochondrial NADH-ubiquinone reductase complex I is nuclear [] and is found in plants [], insects, fungi and higher metazoans []. It appears to act within the membrane and, in mammals, is highly expressed in muscle and neural tissue, indicative of a role in ATP generation [].
Probab=37.32  E-value=62  Score=18.25  Aligned_cols=24  Identities=21%  Similarity=0.419  Sum_probs=20.2

Q ss_pred             ccchhHHHHHHHHHHHHHHHHHHh
Q 040093            7 KLFPTGFYAAISAAMLCFYSYVVA   30 (48)
Q Consensus         7 kifPaG~va~iS~~M~~FY~y~l~   30 (48)
                      -++|=.++..+.+.|++||++..+
T Consensus         5 el~PL~~~vg~a~~~a~~~~~r~l   28 (73)
T PF06522_consen    5 ELYPLFVIVGVAVGGATFYLYRLL   28 (73)
T ss_pred             cccchHHHHHHHHHHHHHHHHHHH
Confidence            467888888899999999999866


No 9  
>COG4858 Uncharacterized membrane-bound protein conserved in bacteria [Function unknown]
Probab=36.82  E-value=26  Score=24.78  Aligned_cols=14  Identities=29%  Similarity=0.313  Sum_probs=6.6

Q ss_pred             hHHHHHHHHHHHHH
Q 040093           11 TGFYAAISAAMLCF   24 (48)
Q Consensus        11 aG~va~iS~~M~~F   24 (48)
                      -|+++++|++|+.|
T Consensus       105 lg~~aLlsgitaff  118 (226)
T COG4858         105 LGAMALLSGITAFF  118 (226)
T ss_pred             HHHHHHHHHHHHHH
Confidence            34445555444443


No 10 
>PTZ00233 variable surface protein Vir18; Provisional
Probab=35.80  E-value=27  Score=26.85  Aligned_cols=31  Identities=19%  Similarity=0.132  Sum_probs=24.7

Q ss_pred             chhHHHHHHHHHHHHHHHHHHhcCCCCCCcccc
Q 040093            9 FPTGFYAAISAAMLCFYSYVVASGGNPPPKKLK   41 (48)
Q Consensus         9 fPaG~va~iS~~M~~FY~y~l~~ggNp~pkk~~   41 (48)
                      +|=|||.+|+++.=-==+|.+|+.-|  +||-+
T Consensus       440 aPmGIvLLLGLLFKyTPLWRvLTKkn--RKk~a  470 (509)
T PTZ00233        440 MPIGIALLLGLLFKYTPLWRVLTKKN--RKKGA  470 (509)
T ss_pred             cchhHHHHHHHhhccchhHHhhhhcc--ccccc
Confidence            69999999976655556999999988  67655


No 11 
>COG5548 Small integral membrane protein [Function unknown]
Probab=35.15  E-value=28  Score=22.07  Aligned_cols=25  Identities=32%  Similarity=0.616  Sum_probs=18.6

Q ss_pred             cccccccchhHHHHHHHHHHHHHHHHH
Q 040093            2 WMQTKKLFPTGFYAAISAAMLCFYSYV   28 (48)
Q Consensus         2 y~~T~kifPaG~va~iS~~M~~FY~y~   28 (48)
                      +++++|.+|++..++..  |.-.|.|+
T Consensus        74 ~~~sRKpvP~~Lt~lgg--~~s~y~y~   98 (105)
T COG5548          74 LVRSRKPVPAGLTTLGG--MLSLYVYV   98 (105)
T ss_pred             ccccCCCcchHHHHHhh--hhhhhhee
Confidence            56899999999988754  55556554


No 12 
>PF09777 OSTMP1:  Osteopetrosis-associated transmembrane protein 1 precursor;  InterPro: IPR019172 Osteopetrosis-associated transmembrane protein 1 (OSTM1) is required for osteoclast and melanocyte maturation and function. Mutations in OSTM1 give rise to autosomal recessive osteopetrosis, also called autosomal recessive Albers-Schonberg disease [, ]. 
Probab=35.02  E-value=59  Score=22.14  Aligned_cols=20  Identities=15%  Similarity=0.047  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHhcCCCCCCc
Q 040093           19 AAMLCFYSYVVASGGNPPPK   38 (48)
Q Consensus        19 ~~M~~FY~y~l~~ggNp~pk   38 (48)
                      ++.++||+-..+.|+...++
T Consensus       201 ~lpv~FY~~s~~~~~~~~r~  220 (237)
T PF09777_consen  201 FLPVLFYLSSYLHSERKKRK  220 (237)
T ss_pred             HHHHHHHHhheeeecccccc
Confidence            45679999999988774444


No 13 
>PTZ00234 variable surface protein Vir12; Provisional
Probab=32.75  E-value=34  Score=25.57  Aligned_cols=27  Identities=15%  Similarity=0.228  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHHHhcCCC---CCCcccc
Q 040093           14 YAAISAAMLCFYSYVVASGGN---PPPKKLK   41 (48)
Q Consensus        14 va~iS~~M~~FY~y~l~~ggN---p~pkk~~   41 (48)
                      +|+|..+..+|| |++.++=.   |.+|+++
T Consensus       371 ~ailGtifFlfy-yn~ss~lks~~~krkrkk  400 (433)
T PTZ00234        371 ASIIGVLVFLFF-FFKSTPIRSQTNKGEKKK  400 (433)
T ss_pred             HHHHHHHHHhhh-hhcccchhccccchhhcc
Confidence            355666666777 67765433   4444433


No 14 
>PF10661 EssA:  WXG100 protein secretion system (Wss), protein EssA;  InterPro: IPR018920  The Wss (WXG100 protein secretion system) in Staphylococcus aureus seems to be encoded by a locus of eight ORFs, called ess (eSAT-6 secretion system) []. This locus encodes, amongst several other proteins, EssA, a protein predicted to possess one transmembrane domain. Due to its predicted membrane location and its absolute requirement for WXG100 protein secretion, it has been speculated that EssA could form a secretion apparatus in conjunction with YukC and YukAB. Proteins homologous to EssA, YukC, EsaA and YukD were absent from mycobacteria [].   Members of this family are associated with type VII secretion of WXG100 family targets in the Firmicutes, but not in the Actinobacteria. This highly divergent protein family consists largely of a central region of highly polar low-complexity sequence containing occasional LF motifs in weak repeats about 17 residues in length, flanked by hydrophobic N- and C-terminal regions. 
Probab=32.46  E-value=65  Score=20.61  Aligned_cols=26  Identities=27%  Similarity=0.227  Sum_probs=17.4

Q ss_pred             cccchhHHHHH-HHHHHHHHHHHHHhc
Q 040093            6 KKLFPTGFYAA-ISAAMLCFYSYVVAS   31 (48)
Q Consensus         6 ~kifPaG~va~-iS~~M~~FY~y~l~~   31 (48)
                      ..+.|.=++++ ..++|+|+=+|.+++
T Consensus       115 ~~~~~~i~~~i~g~ll~i~~giy~~~r  141 (145)
T PF10661_consen  115 KPISPTILLSIGGILLAICGGIYVVLR  141 (145)
T ss_pred             cchhHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34566544444 356888999999875


No 15 
>PF10206 WRW:  Mitochondrial F1F0-ATP synthase, subunit f;  InterPro: IPR019344  This entry represents small proteins of approximately 110 amino acids, which are highly conserved from nematodes to humans. Some have been annotated in Swiss-Prot as being the f subunit of mitochondrial F1F0-ATP synthase but this could not be confirmed. The sequence has a well-conserved WRW motif. The exact function of the protein is not known. 
Probab=31.63  E-value=58  Score=20.27  Aligned_cols=19  Identities=16%  Similarity=0.345  Sum_probs=15.5

Q ss_pred             hHHHHHHHHHHHHHHHHHH
Q 040093           11 TGFYAAISAAMLCFYSYVV   29 (48)
Q Consensus        11 aG~va~iS~~M~~FY~y~l   29 (48)
                      +|+.-++.+.|++||+++-
T Consensus        77 a~~~~v~~g~~~~~Y~~~Y   95 (104)
T PF10206_consen   77 APFFQVLAGYMVFSYCINY   95 (104)
T ss_pred             chhHHHHHHHHHHHHHHhh
Confidence            5677788899999999864


No 16 
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=31.22  E-value=61  Score=22.24  Aligned_cols=34  Identities=21%  Similarity=0.383  Sum_probs=21.7

Q ss_pred             ccccchhHHHHHHHHHHHHHHHHHHhcCCCCCCccc
Q 040093            5 TKKLFPTGFYAAISAAMLCFYSYVVASGGNPPPKKL   40 (48)
Q Consensus         5 T~kifPaG~va~iS~~M~~FY~y~l~~ggNp~pkk~   40 (48)
                      +++|+=. .+++++ +..+|.+|.|+.|+++.++..
T Consensus        12 ~N~iLNi-aI~IV~-lLIiiva~~lf~~~~~~~~~~   45 (217)
T PF07423_consen   12 TNKILNI-AIGIVS-LLIIIVAYQLFFGGDDSPAAS   45 (217)
T ss_pred             hhhhHHH-HHHHHH-HHHHHHhhhheecCCCchhhh
Confidence            3444433 334444 667889999999888666533


No 17 
>PF13197 DUF4013:  Protein of unknown function (DUF4013)
Probab=28.51  E-value=1e+02  Score=18.91  Aligned_cols=26  Identities=23%  Similarity=0.276  Sum_probs=19.3

Q ss_pred             HHHHHHHHHHHHHHHHHhcCC-----CCCCc
Q 040093           13 FYAAISAAMLCFYSYVVASGG-----NPPPK   38 (48)
Q Consensus        13 ~va~iS~~M~~FY~y~l~~gg-----Np~pk   38 (48)
                      .+..+-..-...|.++++++.     +++|+
T Consensus         9 ~i~ii~~~~~~GY~~~v~~~~~~g~~~~lP~   39 (169)
T PF13197_consen    9 IIPIIGLFLLLGYLVRVIRSTAIGGSDPLPE   39 (169)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhccCCCCCCC
Confidence            456677777889999998655     66665


No 18 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=24.75  E-value=1.1e+02  Score=18.39  Aligned_cols=16  Identities=25%  Similarity=0.266  Sum_probs=7.3

Q ss_pred             HHHHHHHHHHHHHHHH
Q 040093           12 GFYAAISAAMLCFYSY   27 (48)
Q Consensus        12 G~va~iS~~M~~FY~y   27 (48)
                      .||.++-++.++||++
T Consensus         7 iii~~i~l~~~~~~~~   22 (130)
T PF12273_consen    7 IIIVAILLFLFLFYCH   22 (130)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3444444444444444


No 19 
>PRK11235 bifunctional antitoxin/transcriptional repressor RelB; Provisional
Probab=24.54  E-value=1.1e+02  Score=18.01  Aligned_cols=22  Identities=27%  Similarity=0.326  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHHhcCCCCCCc
Q 040093           17 ISAAMLCFYSYVVASGGNPPPK   38 (48)
Q Consensus        17 iS~~M~~FY~y~l~~ggNp~pk   38 (48)
                      .|.++..||-+.+..++-|-..
T Consensus        27 ~S~Ai~~fl~qi~~~~~iPF~~   48 (80)
T PRK11235         27 PSEALRLLLQYVAENGRLPFKT   48 (80)
T ss_pred             HHHHHHHHHHHHHHhCCCCCCC
Confidence            5889999999999999997653


No 20 
>PF14019 DUF4235:  Protein of unknown function (DUF4235)
Probab=24.32  E-value=1.5e+02  Score=16.90  Aligned_cols=25  Identities=24%  Similarity=0.329  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHHHHHhcCCCCCCc
Q 040093           13 FYAAISAAMLCFYSYVVASGGNPPPK   38 (48)
Q Consensus        13 ~va~iS~~M~~FY~y~l~~ggNp~pk   38 (48)
                      +.+.+-+-...=.+|...+| ++||+
T Consensus        10 ~~ag~~a~k~~~~~W~~~tg-~~~P~   34 (78)
T PF14019_consen   10 LAAGFLAGKVFEQVWKKVTG-REPPK   34 (78)
T ss_pred             HHHHHHHHHHHHHHHHHHcC-CCCCC
Confidence            34444444556678999988 65564


No 21 
>PF11337 DUF3139:  Protein of unknown function (DUF3139);  InterPro: IPR021486  This family of proteins with unknown function appears to be restricted to Firmicutes. 
Probab=24.19  E-value=84  Score=17.81  Aligned_cols=19  Identities=21%  Similarity=0.135  Sum_probs=14.0

Q ss_pred             HHHHHHHhcCCCCCCcccc
Q 040093           23 CFYSYVVASGGNPPPKKLK   41 (48)
Q Consensus        23 ~FY~y~l~~ggNp~pkk~~   41 (48)
                      +|.++.+...|||-.+..+
T Consensus        18 li~~~~~~~~~~~~~k~~~   36 (85)
T PF11337_consen   18 LIIGIYYFFNGNPYQKHKA   36 (85)
T ss_pred             HHHHHHHhhcCchhhHHHH
Confidence            6777777778988776554


No 22 
>PF12270 Cyt_c_ox_IV:  Cytochrome c oxidase subunit IV;  InterPro: IPR021050  This family of proteins is found in bacteria. Proteins in this family are approximately 140 amino acids in length. This family is the fourth subunit of the cytochrome c oxidase complex. This subunit does not have a catalytic capacity but instead, is required for assembly and/or stability of the complex []. ; GO: 0004129 cytochrome-c oxidase activity, 0055114 oxidation-reduction process, 0016021 integral to membrane
Probab=24.10  E-value=2.1e+02  Score=18.53  Aligned_cols=33  Identities=27%  Similarity=0.264  Sum_probs=22.9

Q ss_pred             chhHHHHHH----HHHHHHHHHHHHhcCCCCCCcccc
Q 040093            9 FPTGFYAAI----SAAMLCFYSYVVASGGNPPPKKLK   41 (48)
Q Consensus         9 fPaG~va~i----S~~M~~FY~y~l~~ggNp~pkk~~   41 (48)
                      =|+|.++++    =++|.+||++...+--.+.|+--.
T Consensus        34 E~~Gt~aL~ls~~l~~mig~yl~~~~rr~~~rPED~~   70 (137)
T PF12270_consen   34 EWVGTVALVLSGGLALMIGFYLRFTARRIGPRPEDRE   70 (137)
T ss_pred             CcchHHHHHHHHHHHHHHHHHHHHHHhhCCCCCcccc
Confidence            467776654    457889999999976666665444


No 23 
>PF04678 DUF607:  Protein of unknown function, DUF607;  InterPro: IPR006769 This entry represents the C-terminal domain of coiled-coil domain containing protein 109.
Probab=23.57  E-value=1.4e+02  Score=19.19  Aligned_cols=24  Identities=8%  Similarity=0.027  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHHHhcCCCCCCcc
Q 040093           16 AISAAMLCFYSYVVASGGNPPPKK   39 (48)
Q Consensus        16 ~iS~~M~~FY~y~l~~ggNp~pkk   39 (48)
                      +.++.+.++|+|-+.++..+.+..
T Consensus       129 v~~~~~i~~y~yfl~t~re~sy~~  152 (180)
T PF04678_consen  129 VGYGTSILGYAYFLYTRREYSYES  152 (180)
T ss_pred             HhHHHHHHHHHHHHHhCCCCChHH
Confidence            334445578999999988876653


No 24 
>PF02468 PsbN:  Photosystem II reaction centre N protein (psbN);  InterPro: IPR003398 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight transmembrane protein PsbN found in PSII. PsbN may have a role in PSII stability, however its actual function unknown. PsbN does not appear to be essential for photoautotrophic growth or normal PSII function.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane
Probab=23.46  E-value=1.4e+02  Score=16.12  Aligned_cols=28  Identities=25%  Similarity=0.489  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHHHHhcCCCCCCcccccc
Q 040093           16 AISAAMLCFYSYVVASGGNPPPKKLKSS   43 (48)
Q Consensus        16 ~iS~~M~~FY~y~l~~ggNp~pkk~~~~   43 (48)
                      .++.+..++=.|.+-++=.||.|++++.
T Consensus        10 ~i~~~lv~~Tgy~iYtaFGppSk~LrDP   37 (43)
T PF02468_consen   10 FISCLLVSITGYAIYTAFGPPSKELRDP   37 (43)
T ss_pred             HHHHHHHHHHhhhhhheeCCCccccCCc
Confidence            3455555666677776666888988763


No 25 
>cd07468 CRD_TK_ROR2 Cysteine-rich domain of tyrosine kinase-like orphan receptor 2. The cysteine-rich domain (CRD) is an essential part of the tyrosine kinase-like orphan receptor (Ror2), a conserved family of tyrosine kinases that function in various processes, including neuronal and skeletal development, cell polarity, and cell movement. Ror proteins are receptors of Wnt proteins, which are key players in a number of fundamental cellular processes in embryogenesis and postnatal development. In different cellular contexts, Ror proteins can either activate or repress transcription of Wnt target genes, and can modulate Wnt signaling by sequestering Wnt ligands. In addition, a number of Wnt-independent functions have been proposed for both Ror1 and Ror2.
Probab=23.00  E-value=47  Score=21.63  Aligned_cols=22  Identities=14%  Similarity=0.614  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHh--cCCCCCCcc
Q 040093           18 SAAMLCFYSYVVA--SGGNPPPKK   39 (48)
Q Consensus        18 S~~M~~FY~y~l~--~ggNp~pkk   39 (48)
                      +.-++|+|++-+-  +++.|+|++
T Consensus        58 A~~~LC~~~Fp~C~~~~~~p~pr~   81 (140)
T cd07468          58 AIPSFCHFVFPLCDDRSRTPKPRE   81 (140)
T ss_pred             HHHHHHHHcCCCCCCCCCCCCCcc
Confidence            4568999999988  466676654


No 26 
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=22.94  E-value=1.3e+02  Score=15.84  Aligned_cols=18  Identities=11%  Similarity=0.586  Sum_probs=9.5

Q ss_pred             hHHHHHHHHHHHHHHHHH
Q 040093           11 TGFYAAISAAMLCFYSYV   28 (48)
Q Consensus        11 aG~va~iS~~M~~FY~y~   28 (48)
                      +|+++.++.+.+|+..|-
T Consensus        10 v~V~vg~~iiii~~~~Ya   27 (38)
T PF02439_consen   10 VAVVVGMAIIIICMFYYA   27 (38)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            355555555555555543


No 27 
>TIGR03685 L21P_arch 50S ribosomal protein L12P. This model represents the L12P protein of the large (50S) subunit of the archaeal ribosome.
Probab=22.83  E-value=63  Score=19.73  Aligned_cols=15  Identities=27%  Similarity=0.461  Sum_probs=11.1

Q ss_pred             HHHHHHHHHh-cCCCC
Q 040093           21 MLCFYSYVVA-SGGNP   35 (48)
Q Consensus        21 M~~FY~y~l~-~ggNp   35 (48)
                      |=|-|+|-|+ .+||+
T Consensus         1 M~yvyA~Lll~~~g~~   16 (105)
T TIGR03685         1 MEYIYAALLLHSAGKE   16 (105)
T ss_pred             CHHHHHHHHHHhcCCC
Confidence            5688999999 55553


No 28 
>PRK12573 putative monovalent cation/H+ antiporter subunit B; Reviewed
Probab=22.14  E-value=2.1e+02  Score=18.11  Aligned_cols=26  Identities=19%  Similarity=0.373  Sum_probs=18.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHhcCCCCC
Q 040093           11 TGFYAAISAAMLCFYSYVVASGGNPP   36 (48)
Q Consensus        11 aG~va~iS~~M~~FY~y~l~~ggNp~   36 (48)
                      .-+.-++.-.+..|=+|.+++|-|.|
T Consensus         9 r~~~r~l~p~i~l~s~yv~l~GH~~P   34 (140)
T PRK12573          9 RTVAKIVTFIILLFSVFLFLAGHNEP   34 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCCCCC
Confidence            33445666778888888888888855


No 29 
>PF06939 DUF1286:  Protein of unknown function (DUF1286);  InterPro: IPR009705 This entry is represented by Sulfolobus virus STSV1, Orf8. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several hypothetical archaeal proteins of around 120 residues in length. All members of this family seem to be Sulfolobus species specific. The function of this family is unknown.
Probab=21.49  E-value=1.2e+02  Score=19.42  Aligned_cols=24  Identities=33%  Similarity=0.610  Sum_probs=20.0

Q ss_pred             cccccccchhHHHHHHHHHHH-HHH
Q 040093            2 WMQTKKLFPTGFYAAISAAML-CFY   25 (48)
Q Consensus         2 y~~T~kifPaG~va~iS~~M~-~FY   25 (48)
                      =++|+-+|-+|++++++.... -||
T Consensus         2 kL~tHyVFs~GlLtLl~s~~~~~f~   26 (114)
T PF06939_consen    2 KLRTHYVFSTGLLTLLSSFFLSNFY   26 (114)
T ss_pred             ceeeeehhhhhHHHHHHHHHHhhHH
Confidence            367899999999999998777 555


No 30 
>PF06679 DUF1180:  Protein of unknown function (DUF1180);  InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown.
Probab=21.45  E-value=1.4e+02  Score=19.67  Aligned_cols=26  Identities=12%  Similarity=0.091  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHHHHhcCCCCCCc
Q 040093           13 FYAAISAAMLCFYSYVVASGGNPPPK   38 (48)
Q Consensus        13 ~va~iS~~M~~FY~y~l~~ggNp~pk   38 (48)
                      |+.++|++..+..+.+..+-+++..|
T Consensus       100 Vl~g~s~l~i~yfvir~~R~r~~~rk  125 (163)
T PF06679_consen  100 VLVGLSALAILYFVIRTFRLRRRNRK  125 (163)
T ss_pred             HHHHHHHHHHHHHHHHHHhhcccccc
Confidence            45566666666677778877775554


No 31 
>PRK13183 psbN photosystem II reaction center protein N; Provisional
Probab=21.13  E-value=1.3e+02  Score=16.52  Aligned_cols=28  Identities=25%  Similarity=0.444  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHHHHHhcCCCCCCcccccc
Q 040093           16 AISAAMLCFYSYVVASGGNPPPKKLKSS   43 (48)
Q Consensus        16 ~iS~~M~~FY~y~l~~ggNp~pkk~~~~   43 (48)
                      .++.+..++=.|.|-++=.||.|.+.+.
T Consensus        13 ~i~~lL~~~TgyaiYtaFGppSk~LrDP   40 (46)
T PRK13183         13 TILAILLALTGFGIYTAFGPPSKELDDP   40 (46)
T ss_pred             HHHHHHHHHhhheeeeccCCcccccCCc
Confidence            4666777777888888888888888753


No 32 
>KOG4697 consensus Integral membrane protein involved in transport between the late Golgi and endosome [Intracellular trafficking, secretion, and vesicular transport]
Probab=21.11  E-value=1.2e+02  Score=20.55  Aligned_cols=27  Identities=19%  Similarity=0.173  Sum_probs=21.7

Q ss_pred             HHHHHHHHHHHHHHHHhcCCCCCCccc
Q 040093           14 YAAISAAMLCFYSYVVASGGNPPPKKL   40 (48)
Q Consensus        14 va~iS~~M~~FY~y~l~~ggNp~pkk~   40 (48)
                      ..+.+++.++||+++.+++.|-..+.+
T Consensus        25 ~~vy~t~~ll~~~~~kL~~d~~~~e~L   51 (160)
T KOG4697|consen   25 IFVYTTAILLFYCWAKLAYDLNIKEWL   51 (160)
T ss_pred             hHHHHHHHHHHHHHHHHhhhhcchhhh
Confidence            567899999999999999888655443


Done!