Citrus Sinensis ID: 040101


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
TFIQKTKKLYQDTRTQRNIAKLNDELYEVHQIMTRNVQEVLGVGEKLDQVSEMSSRLTSESRIYADKAKDLNRQALIRKWAPVAIVLGVVFVVFWLKTKLW
cHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
TFIQK************NIAKLNDELYEVHQIMTRNVQEVLGVGEKLDQVSEMS**L***SRIYADKAKDLNRQALIRKWAPVAIVLGVVFVVFWLKTKLW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TFIQKTKKLYQDTRTQRNIAKLNDELYEVHQIMTRNVQEVLGVGEKLDQVSEMSSRLTSESRIYADKAKDLNRQALIRKWAPVAIVLGVVFVVFWLKTKLW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
25.3 kDa vesicle transport protein V-SNARE involved in vesicle trafficking from the ER to the Golgi complex.probableQ94AU2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NUT, chain C
Confidence level:very confident
Coverage over the Query: 2-13,31-41
View the alignment between query and template
View the model in PyMOL
Template: 3HD7, chain A
Confidence level:very confident
Coverage over the Query: 15-83
View the alignment between query and template
View the model in PyMOL