Query         040150
Match_columns 85
No_of_seqs    83 out of 85
Neff          4.9 
Searched_HMMs 46136
Date          Fri Mar 29 05:36:21 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/040150.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/040150hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12515 CaATP_NAI:  Ca2+-ATPas  99.8 3.5E-22 7.5E-27  118.1   2.7   46    4-50      1-46  (47)
  2 KOG0204 Calcium transporting A  98.5 7.2E-08 1.6E-12   83.5   3.5   69    4-78      2-70  (1034)
  3 PF04081 DNA_pol_delta_4:  DNA   72.6     2.6 5.7E-05   29.3   1.7   32    7-39     69-103 (124)
  4 PF10579 Rapsyn_N:  Rapsyn N-te  36.8      58  0.0013   21.1   3.3   53   15-70     19-71  (80)
  5 PF01286 XPA_N:  XPA protein N-  29.4      27 0.00059   19.1   0.7   12    1-13     14-25  (34)
  6 PHA00649 hypothetical protein   16.0      91   0.002   20.1   1.2    9   21-29     45-53  (83)
  7 PF08499 PDEase_I_N:  3'5'-cycl  14.2 1.7E+02  0.0036   17.9   2.0   46   12-75     12-57  (59)
  8 PF15265 FAM196:  FAM196 family  11.1 1.7E+02  0.0037   24.8   1.8   27   44-70    392-419 (514)
  9 PF13411 MerR_1:  MerR HTH fami  10.7 2.1E+02  0.0046   16.1   1.7   20   16-37     11-30  (69)
 10 PF06592 DUF1138:  Protein of u  10.5      84  0.0018   20.1  -0.1   24   18-41     45-70  (73)

No 1  
>PF12515 CaATP_NAI:  Ca2+-ATPase N terminal autoinhibitory domain;  InterPro: IPR024750 This entry represents the N-terminal autoinhibitory calmodulin-binding domain characteristic of certain calcium-transporting ATPases []. This domain binds calmodulin in a calcium-dependent fashion and has a conserved RRFR sequence motif. There are two completely conserved residues (F and W) that may be functionally important.; GO: 0005516 calmodulin binding
Probab=99.85  E-value=3.5e-22  Score=118.07  Aligned_cols=46  Identities=59%  Similarity=1.018  Sum_probs=43.8

Q ss_pred             cccccCCCCCCCCCcHHHHHHHHHHhchhcccCCCCCcchhchhhhH
Q 040150            4 YLNENFGSVKPKNSSEEALQRWRRLYGIVKNPKRSFPFTANLAKRSE   50 (85)
Q Consensus         4 ~~~~~F~~i~~k~~s~ealrRWR~A~~lviN~~RRFr~~adL~kr~~   50 (85)
                      |+.++|+ |++||+|+|+++|||+|+|||+|++|||||++||+|+++
T Consensus         1 yl~~~Fd-i~~Kn~s~e~l~rWR~a~~lv~N~~RRFR~~~dL~k~~e   46 (47)
T PF12515_consen    1 YLDDNFD-IPAKNSSEEALRRWRQAVGLVKNARRRFRYTADLKKREE   46 (47)
T ss_pred             CCccccC-CCCCCCCHHHHHHHHHHhHHhccccceeeecccHhhHhc
Confidence            6789999 999999999999999999999999999999999998875


No 2  
>KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism]
Probab=98.51  E-value=7.2e-08  Score=83.46  Aligned_cols=69  Identities=38%  Similarity=0.422  Sum_probs=63.7

Q ss_pred             cccccCCCCCCCCCcHHHHHHHHHHhchhcccCCCCCcchhchhhhHHHHHHhhhhhhhhhhhHHHHHHHHhhhh
Q 040150            4 YLNENFGSVKPKNSSEEALQRWRRLYGIVKNPKRSFPFTANLAKRSEAEAIRRSNQVSFLLKGSLNLKFLITSTL   78 (85)
Q Consensus         4 ~~~~~F~~i~~k~~s~ealrRWR~A~~lviN~~RRFr~~adL~kr~~~~~~rr~~q~kir~~~~v~~a~~~~~~~   78 (85)
                      ++.++|. .+.+|++.+++++||.|+ +++|++|||+|.++|++..+...+|+    |+|+++.+++|+.+|.|-
T Consensus         2 ~~~~~~~-~~~~n~~~~~~~~~~~a~-~~~~~~~~~~~~~~l~~~~~~~~~r~----~~r~~~~~~~a~~~~~~~   70 (1034)
T KOG0204|consen    2 LLDKDFV-VSMKNSSIEALQRWRLAY-IVLEASRRFRFGASLKKLRELMEPRR----KIRSAVLVSKAAALFIDA   70 (1034)
T ss_pred             Ccccccc-cccccchhhhhhhhhhhh-hhcccchhhccccCHHHHHHHHHHHh----hhhhhhcccchhhhhhcc
Confidence            4567787 888999999999999888 99999999999999999999999998    999999999999999875


No 3  
>PF04081 DNA_pol_delta_4:  DNA polymerase delta, subunit 4 ;  InterPro: IPR007218 DNA polymerase is responsible for effective DNA replication. The function of the delta subunit 4 of DNA polymerase is not yet known.; GO: 0006260 DNA replication, 0005634 nucleus
Probab=72.57  E-value=2.6  Score=29.34  Aligned_cols=32  Identities=22%  Similarity=0.410  Sum_probs=23.8

Q ss_pred             ccCCCCCCCC-CcH--HHHHHHHHHhchhcccCCCC
Q 040150            7 ENFGSVKPKN-SSE--EALQRWRRLYGIVKNPKRSF   39 (85)
Q Consensus         7 ~~F~~i~~k~-~s~--ealrRWR~A~~lviN~~RRF   39 (85)
                      ..|| +.++. |-.  ..++||.+|..+.+||.=-.
T Consensus        69 r~FD-l~~~yGPC~GitRl~RW~RA~~lgL~PP~ev  103 (124)
T PF04081_consen   69 RQFD-LSSQYGPCIGITRLERWERAKRLGLNPPIEV  103 (124)
T ss_pred             HHhc-cccccCCccCchHHHHHHHHHHcCCCCCHHH
Confidence            4588 88775 433  48999999987999887544


No 4  
>PF10579 Rapsyn_N:  Rapsyn N-terminal myristoylation and linker region;  InterPro: IPR019568  Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane. Rapsyn is a peripheral membrane protein that is selectively concentrated at the neuromuscular junction and is essential for the formation of synaptic acetylcholine receptor aggregates. Acetylcholine receptors fail to aggregate beneath nerve terminals in mice where rapsyn has been knocked out. The N-terminal six amino acids of rapsyn are its myristoylation site, and myristoylation is necessary for the targeting of the protein to the membrane []. ; GO: 0008270 zinc ion binding, 0033130 acetylcholine receptor binding, 0007268 synaptic transmission, 0005856 cytoskeleton, 0030054 cell junction, 0045211 postsynaptic membrane
Probab=36.80  E-value=58  Score=21.05  Aligned_cols=53  Identities=17%  Similarity=0.236  Sum_probs=29.7

Q ss_pred             CCCcHHHHHHHHHHhchhcccCCCCCcchhchhhhHHHHHHhhhhhhhhhhhHHHH
Q 040150           15 KNSSEEALQRWRRLYGIVKNPKRSFPFTANLAKRSEAEAIRRSNQVSFLLKGSLNL   70 (85)
Q Consensus        15 k~~s~ealrRWR~A~~lviN~~RRFr~~adL~kr~~~~~~rr~~q~kir~~~~v~~   70 (85)
                      +|-..+++..|++|..-.-++.-||+...=|   ..+...=.+.++.+..+..-+.
T Consensus        19 ~~~~~~Al~~W~~aL~k~~~~~~rf~~lG~l---~qA~~e~Gkyr~~L~fA~~Q~~   71 (80)
T PF10579_consen   19 QNETQQALQKWRKALEKITDREDRFRVLGYL---IQAHMEWGKYREMLAFALQQLE   71 (80)
T ss_pred             cchHHHHHHHHHHHHhhcCChHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHH
Confidence            5667889999999985555555566533322   2233333334445554444443


No 5  
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=29.36  E-value=27  Score=19.09  Aligned_cols=12  Identities=42%  Similarity=0.825  Sum_probs=8.0

Q ss_pred             CcccccccCCCCC
Q 040150            1 MENYLNENFGSVK   13 (85)
Q Consensus         1 ~~~~~~~~F~~i~   13 (85)
                      |+|||..+|+ ++
T Consensus        14 ~dSyL~~~F~-~~   25 (34)
T PF01286_consen   14 MDSYLLNNFD-LP   25 (34)
T ss_dssp             S-SSCCCCTS--S
T ss_pred             HHHHHHHhCC-cc
Confidence            5788888898 54


No 6  
>PHA00649 hypothetical protein
Probab=16.02  E-value=91  Score=20.14  Aligned_cols=9  Identities=22%  Similarity=0.095  Sum_probs=7.7

Q ss_pred             HHHHHHHHh
Q 040150           21 ALQRWRRLY   29 (85)
Q Consensus        21 alrRWR~A~   29 (85)
                      -+||||+|.
T Consensus        45 ~~Rr~RKA~   53 (83)
T PHA00649         45 FGRRMRKAA   53 (83)
T ss_pred             HHHHHHHHh
Confidence            389999997


No 7  
>PF08499 PDEase_I_N:  3'5'-cyclic nucleotide phosphodiesterase N-terminal;  InterPro: IPR013706 The cyclic nucleotide phosphodiesterases (PDE) comprise a group of enzymes that degrade the phosphodiester bond in the second messenger molecules cAMP and cGMP. They are divided into 11 families. They regulate the localisation, duration and amplitude of cyclic nucleotide signalling within subcellular domains. PDEs are therefore important for signal transduction. PDE enzymes are often targets for pharmacological inhibition due to their unique tissue distribution, structural properties, and functional properties. Inhibitors include: Roflumilast for chronic obstructive pulmonary disease and asthma [], Sildenafil for erectile dysfunction [] and Cilostazol for peripheral arterial occlusive disease [], amongst others. Retinal 3',5'-cGMP phosphodiesterase is located in photoreceptor outer segments: it is light activated, playing a pivotal role in signal transduction. In rod cells, PDE is oligomeric, comprising an alpha-, a beta- and 2 gamma-subunits, while in cones, PDE is a homodimer of alpha chains, which are associated with several smaller subunits. Both rod and cone PDEs catalyse the hydrolysis of cAMP or cGMP to the corresponding nucleoside 5' monophosphates, both enzymes also binding cGMP with high affinity. The cGMP-binding sites are located in the N-terminal half of the protein sequence, while the catalytic core resides in the C-terminal portion. This domain is found to the N terminus of the calcium/calmodulin-dependent 3'5'-cyclic nucleotide phosphodiesterase domain (IPR002073 from INTERPRO).; GO: 0004114 3',5'-cyclic-nucleotide phosphodiesterase activity
Probab=14.24  E-value=1.7e+02  Score=17.91  Aligned_cols=46  Identities=11%  Similarity=0.205  Sum_probs=28.5

Q ss_pred             CCCCCCcHHHHHHHHHHhchhcccCCCCCcchhchhhhHHHHHHhhhhhhhhhhhHHHHHHHHh
Q 040150           12 VKPKNSSEEALQRWRRLYGIVKNPKRSFPFTANLAKRSEAEAIRRSNQVSFLLKGSLNLKFLIT   75 (85)
Q Consensus        12 i~~k~~s~ealrRWR~A~~lviN~~RRFr~~adL~kr~~~~~~rr~~q~kir~~~~v~~a~~~~   75 (85)
                      |.+...|.| .+.|=.++ ++.          ....+. .+++     -++|..++++++-+.|
T Consensus        12 i~~dsvp~e-Vr~WLasT-Ftr----------q~~~~~-~~ek-----~~frsV~~AvqagIfv   57 (59)
T PF08499_consen   12 IQSDSVPDE-VRDWLAST-FTR----------QVTRRR-SEEK-----PKFRSVVHAVQAGIFV   57 (59)
T ss_pred             cccccCCHH-HHHHHHHH-HHh----------hhhccc-cccc-----hhHHHHHHHHHhccee
Confidence            666666666 89999988 433          331111 1222     2688889998887654


No 8  
>PF15265 FAM196:  FAM196 family
Probab=11.06  E-value=1.7e+02  Score=24.81  Aligned_cols=27  Identities=19%  Similarity=0.079  Sum_probs=20.6

Q ss_pred             hchhhhH-HHHHHhhhhhhhhhhhHHHH
Q 040150           44 NLAKRSE-AEAIRRSNQVSFLLKGSLNL   70 (85)
Q Consensus        44 dL~kr~~-~~~~rr~~q~kir~~~~v~~   70 (85)
                      ||.-+.. -|+....+||||.|.+.||.
T Consensus       392 dLqaqLQsmEe~L~SnQEtIKVLLnVIQ  419 (514)
T PF15265_consen  392 DLQAQLQSMEESLSSNQETIKVLLNVIQ  419 (514)
T ss_pred             hHHHHHHHHHHHHHhhhHHHHHHHHHHH
Confidence            4444333 57778889999999999995


No 9  
>PF13411 MerR_1:  MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B.
Probab=10.66  E-value=2.1e+02  Score=16.10  Aligned_cols=20  Identities=25%  Similarity=0.326  Sum_probs=15.3

Q ss_pred             CCcHHHHHHHHHHhchhcccCC
Q 040150           16 NSSEEALQRWRRLYGIVKNPKR   37 (85)
Q Consensus        16 ~~s~ealrRWR~A~~lviN~~R   37 (85)
                      +.|..+++.|.+.. + +.|.|
T Consensus        11 gvs~~tlr~y~~~g-l-l~~~~   30 (69)
T PF13411_consen   11 GVSPSTLRYYEREG-L-LPPPR   30 (69)
T ss_dssp             TTTHHHHHHHHHTT-S-STTBE
T ss_pred             CcCHHHHHHHHHhc-C-ccccc
Confidence            46788999999998 7 44544


No 10 
>PF06592 DUF1138:  Protein of unknown function (DUF1138);  InterPro: IPR009515 This family consists of several hypothetical short plant proteins from Arabidopsis thaliana and Oryza sativa. The function of this family is unknown.
Probab=10.52  E-value=84  Score=20.11  Aligned_cols=24  Identities=33%  Similarity=0.642  Sum_probs=0.0

Q ss_pred             cHHHHHHHHHHhc--hhcccCCCCCc
Q 040150           18 SEEALQRWRRLYG--IVKNPKRSFPF   41 (85)
Q Consensus        18 s~ealrRWR~A~~--lviN~~RRFr~   41 (85)
                      ..+.++-|.+-+|  ||+||.+|=.|
T Consensus        45 T~~K~qaWPR~agpPVvmNPisrqnf   70 (73)
T PF06592_consen   45 TDKKFQAWPREAGPPVVMNPISRQNF   70 (73)
T ss_pred             HHHHHhhCcccCCCCeeeccccccce


Done!