Citrus Sinensis ID: 040150

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MENYLNENFGSVKPKNSSEEALQRWRRLYGIVKNPKRSFPFTANLAKRSEAEAIRRSNQVSFLLKGSLNLKFLITSTLTDWLKLK
ccccccccccccccccccHHHHHHHHHHHcHHccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccc
**NYL*ENFG************QRWRRLYGIVKNPKRSFPFTANLA*******IRRSNQVSFLLKGSLNLKFLITSTLTDWLKL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENYLNENFGSVKPKNSSEEALQRWRRLYGIVKNPKRSFPFTANLAKRSEAEAIRRSNQVSFLLKGSLNLKFLITSTLTDWLKLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcium-transporting ATPase 1, chloroplastic This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.probableQ37145

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AQR, chain D
Confidence level:confident
Coverage over the Query: 17-78
View the alignment between query and template
View the model in PyMOL