Citrus Sinensis ID: 040152


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---
MVQYNFKKITVVPNGKDIVDIILSRTQRQTPTVVHKGYSITRLRQFYMRKVKYTQQNFFEKLSTIIDEFPRLDDIHPFYGDLLHVLYNKDHYKLALGQINTARNLISKIAKDYVKLLKYGDSLYRCKSLKVAALGRMCTVVKRIGPSLAYLEQIRQHMARLPSIDPNTRTILICGYPNVGKSSFMNKITRADVDVQPYAFTTKSLFVGHTDYKYLRYQVIDTPGILDRPFEDRNIIEMCSITALAHLRSAVLFFLDISGSCGYSIAQQAALFHSIKSLFMNKPLIIVCNKTDL
ccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccEEEEEcccccccHHHHHHHcccccccccccccccccEEEEEECccEEEEEECcccccccccccccHHHHHHHHHHHHHHHcEEEEEEccccccccHHHHHHHHHHHHHHcccccEEEEEEcccc
***YNFKKITVVPNGKDIVDIILSRTQRQTPTVVHKGYSITRLRQFYMRKVKYTQQNFFEKLSTIIDEFPRLDDIHPFYGDLLHVLYNKDHYKLALGQINTARNLISKIAKDYVKLLKYGDSLYRCKSLKVAALGRMCTVVKRIGPSLAYLEQIRQHMARLPSIDPNTRTILICGYPNVGKSSFMNKITRADVDVQPYAFTTKSLFVGHTDYKYLRYQVIDTPGILDRPFEDRNIIEMCSITALAHLRSAVLFFLDISGSCGYSIAQQAALFHSIKSLFMNKPLIIVCNKTDL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQYNFKKITVVPNGKDIVDIILSRTQRQTPTVVHKGYSITRLRQFYMRKVKYTQQNFFEKLSTIIDEFPRLDDIHPFYGDLLHVLYNKDHYKLALGQINTARNLISKIAKDYVKLLKYGDSLYRCKSLKVAALGRMCTVVKRIGPSLAYLEQIRQHMARLPSIDPNTRTILICGYPNVGKSSFMNKITRADVDVQPYAFTTKSLFVGHTDYKYLRYQVIDTPGILDRPFEDRNIIEMCSITALAHLRSAVLFFLDISGSCGYSIAQQAALFHSIKSLFMNKPLIIVCNKTDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nucleolar GTP-binding protein 1 Involved in the biogenesis of the 60S ribosomal subunit.probableQ9C6I8
Probable nucleolar GTP-binding protein 1 Involved in the biogenesis of the 60S ribosomal subunit.probableQ9V411
Nucleolar GTP-binding protein 1 Involved in the biogenesis of the 60S ribosomal subunit.probableQ9BZE4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E87, chain A
Confidence level:very confident
Coverage over the Query: 3-293
View the alignment between query and template
View the model in PyMOL