BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 040162
(395 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2J8P|A Chain A, Nmr Structure Of C-Terminal Domain Of Human Cstf-64
Length = 49
Score = 35.0 bits (79), Expect = 0.082, Method: Compositional matrix adjust.
Identities = 15/30 (50%), Positives = 24/30 (80%)
Query: 362 ALLQQVMSLSPEQISLLPPEQRNQVLQLQQ 391
AL+ QV+ L+ +QI++LPPEQR +L L++
Sbjct: 11 ALIMQVLQLTADQIAMLPPEQRQSILILKE 40
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.125 0.360
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,492,593
Number of Sequences: 62578
Number of extensions: 315030
Number of successful extensions: 452
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 451
Number of HSP's gapped (non-prelim): 2
length of query: 395
length of database: 14,973,337
effective HSP length: 101
effective length of query: 294
effective length of database: 8,652,959
effective search space: 2543969946
effective search space used: 2543969946
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 52 (24.6 bits)