Query         040193
Match_columns 80
No_of_seqs    101 out of 108
Neff          6.2 
Searched_HMMs 46136
Date          Fri Mar 29 06:01:04 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/040193.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/040193hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07333 SLR1-BP:  S locus-rela  99.7 2.8E-17 6.1E-22   95.0   4.1   54   23-80      1-58  (58)
  2 PF10868 DUF2667:  Protein of u  98.0   1E-05 2.2E-10   50.9   3.7   73    3-79      5-80  (90)
  3 PF00451 Toxin_2:  Scorpion sho  90.6    0.67 1.5E-05   23.8   3.6   29   41-77      3-32  (32)
  4 PF07127 Nodulin_late:  Late no  90.4    0.35 7.7E-06   27.1   2.7   25    1-27      1-25  (54)
  5 PF00304 Gamma-thionin:  Gamma-  88.9    0.75 1.6E-05   25.1   3.2   35   39-80     12-47  (47)
  6 PF12606 RELT:  Tumour necrosis  88.6    0.74 1.6E-05   25.9   3.1   34    1-36      1-34  (50)
  7 PF11415 Toxin_37:  Antifungal   87.5     1.2 2.7E-05   23.3   3.3   33   41-79      1-33  (35)
  8 PF15240 Pro-rich:  Proline-ric  86.8    0.34 7.5E-06   33.9   1.2   19   11-29      1-19  (179)
  9 PF02402 Lysis_col:  Lysis prot  74.9     1.5 3.2E-05   24.3   0.8   18    1-18      1-18  (46)
 10 smart00505 Knot1 Knottins. Kno  71.1     4.1 8.9E-05   21.3   2.0   33   39-78     11-45  (45)
 11 PHA03072 putative viral membra  66.2     5.8 0.00013   28.0   2.4   20    2-21     27-46  (190)
 12 PF03356 Pox_LP_H2:  Viral late  63.0     6.9 0.00015   27.6   2.3   20    2-21     27-46  (189)
 13 PF11714 Inhibitor_I53:  Thromb  62.3     8.8 0.00019   23.3   2.3   20    7-26      4-23  (78)
 14 PF13956 Ibs_toxin:  Toxin Ibs,  59.7     5.4 0.00012   18.1   0.8   10    8-17      6-15  (19)
 15 PHA02291 hypothetical protein   58.2      12 0.00026   24.6   2.6   17    1-17      1-18  (132)
 16 PF04202 Mfp-3:  Foot protein 3  57.4       9 0.00019   23.0   1.8   15    1-15      1-15  (71)
 17 PHA03255 BDLF3; Provisional     56.7      10 0.00022   26.9   2.2   15    8-22    193-208 (234)
 18 cd00107 Knot1 The "knottin" fo  56.2      13 0.00029   18.4   2.1   30   41-77      3-33  (33)
 19 COG2991 Uncharacterized protei  55.9      10 0.00023   23.0   1.9   18   31-51     31-52  (77)
 20 PF05294 Toxin_5:  Scorpion sho  54.0      15 0.00034   18.8   2.1   20   44-76     13-32  (32)
 21 PF10828 DUF2570:  Protein of u  52.1      20 0.00044   22.6   2.9   21    1-21      1-21  (110)
 22 PF01097 Defensin_2:  Arthropod  52.1      33 0.00071   17.6   3.2   27   43-77      8-34  (34)
 23 PF14147 Spore_YhaL:  Sporulati  50.8      20 0.00043   20.4   2.4   20    7-27      5-24  (52)
 24 PLN00214 putative protein; Pro  49.1     7.8 0.00017   25.4   0.6   28    1-28      1-32  (115)
 25 CHL00020 psbN photosystem II p  47.9      23 0.00049   19.4   2.3   18    1-18      1-18  (43)
 26 PF03929 PepSY_TM:  PepSY-assoc  45.2      33 0.00071   16.7   2.4   13    7-19     12-24  (27)
 27 TIGR01606 holin_BlyA holin, Bl  42.2      38 0.00083   19.9   2.8   20    2-21     16-35  (63)
 28 PRK13183 psbN photosystem II r  41.2      36 0.00078   18.8   2.4   18    1-18      4-21  (46)
 29 COG3771 Predicted membrane pro  40.7      27 0.00059   22.1   2.1   14    8-21      3-16  (97)
 30 PF08027 Albumin_I:  Albumin I;  40.5      12 0.00025   24.7   0.5   30   32-66     25-54  (120)
 31 KOG4063 Major epididymal secre  37.1      45 0.00098   23.0   2.9   40    3-46      2-50  (158)
 32 PF10690 Myticin-prepro:  Mytic  35.9      42  0.0009   21.3   2.4   32   12-54      7-38  (98)
 33 PHA02706 hypothetical protein;  33.1      53  0.0011   18.6   2.3   16    6-21      7-22  (58)
 34 PF12729 4HB_MCP_1:  Four helix  32.7      52  0.0011   20.3   2.6   14    3-16      7-20  (181)
 35 TIGR02209 ftsL_broad cell divi  31.6      63  0.0014   18.7   2.7    6    1-6       1-6   (85)
 36 COG5487 Small integral membran  31.1      60  0.0013   18.5   2.3   15    2-17     31-45  (54)
 37 PF05102 Holin_BlyA:  holin, Bl  30.8      79  0.0017   18.5   2.9   19    3-21     17-35  (61)
 38 PF08120 Toxin_32:  Tamulustoxi  30.3     7.8 0.00017   19.9  -1.3   33   41-77      2-34  (35)
 39 PF02060 ISK_Channel:  Slow vol  30.3      45 0.00098   22.2   2.0   15    5-19     43-57  (129)
 40 PF09771 Tmemb_18A:  Transmembr  29.2      36 0.00078   22.5   1.4   20   24-43     86-111 (125)
 41 PF10794 DUF2606:  Protein of u  29.2      43 0.00092   22.3   1.7   25    3-27     13-37  (131)
 42 PF11912 DUF3430:  Protein of u  29.1      52  0.0011   22.2   2.2   13    3-15      2-14  (212)
 43 PF13172 PepSY_TM_1:  PepSY-ass  27.8      87  0.0019   15.5   2.4   14    8-21     17-30  (34)
 44 TIGR00247 conserved hypothetic  27.7      68  0.0015   24.0   2.8   16    1-16      1-16  (342)
 45 PRK13664 hypothetical protein;  27.7      71  0.0015   18.6   2.3   15   11-25     12-26  (62)
 46 PF00008 EGF:  EGF-like domain   26.5      50  0.0011   16.1   1.4   18   58-77      8-25  (32)
 47 PF11395 DUF2873:  Protein of u  25.7 1.2E+02  0.0026   16.2   3.0   10   25-34     33-42  (43)
 48 KOG3384 Selenoprotein [General  25.5      73  0.0016   21.7   2.4   32    1-35      1-32  (154)
 49 PRK09039 hypothetical protein;  25.2      73  0.0016   24.0   2.6   11   11-21     29-39  (343)
 50 PF10731 Anophelin:  Thrombin i  24.8      72  0.0016   18.8   2.0   15    1-15      1-16  (65)
 51 PHA00645 hypothetical protein   24.7      49  0.0011   21.6   1.4   28    1-28     38-65  (125)
 52 PRK12750 cpxP periplasmic repr  24.5      74  0.0016   21.7   2.3   21    1-21      3-23  (170)
 53 PF11044 TMEMspv1-c74-12:  Plec  24.2 1.1E+02  0.0023   17.0   2.5   13    7-19      6-18  (49)
 54 PF08999 SP_C-Propep:  Surfacta  23.5 1.1E+02  0.0025   19.0   2.8   15   15-29     50-64  (93)
 55 PF13706 PepSY_TM_3:  PepSY-ass  22.9 1.2E+02  0.0026   15.3   2.6   14    8-21     16-29  (37)
 56 CHL00031 psbT photosystem II p  22.8 1.3E+02  0.0027   15.5   2.5   13    6-18      4-16  (33)
 57 PRK11875 psbT photosystem II r  22.8 1.2E+02  0.0027   15.4   2.7   13    6-18      4-16  (31)
 58 PF02468 PsbN:  Photosystem II   22.1      80  0.0017   17.2   1.7   15    4-18      4-18  (43)
 59 PHA03066 Hypothetical protein;  22.0      98  0.0021   20.1   2.4   18    1-18      1-18  (110)
 60 KOG4455 Uncharacterized conser  21.9 1.2E+02  0.0027   19.6   2.8   21    7-29     53-73  (110)
 61 PF02495 7kD_coat:  7kD viral c  21.6 1.6E+02  0.0035   16.3   3.1    8   31-38     25-32  (59)
 62 PF04068 RLI:  Possible Fer4-li  21.2      22 0.00049   18.2  -0.6   16   37-52      6-23  (35)
 63 PLN03207 stomagen; Provisional  20.9 1.3E+02  0.0027   19.5   2.7   10   11-20     19-28  (113)
 64 PF14865 Macin:  Macin; PDB: 2K  20.8 1.3E+02  0.0029   17.4   2.6   21   44-67     22-42  (59)
 65 PF13980 UPF0370:  Uncharacteri  20.3 1.1E+02  0.0024   17.9   2.1   15   11-25     11-25  (63)
 66 KOG3950 Gamma/delta sarcoglyca  20.3   1E+02  0.0022   23.1   2.4   12    6-17     36-47  (292)
 67 COG3354 FlaG Putative archaeal  20.2 1.4E+02   0.003   20.5   2.9   18    4-21      6-23  (154)
 68 PF15048 OSTbeta:  Organic solu  20.2 1.4E+02   0.003   19.8   2.9   18    4-21     37-54  (125)
 69 TIGR03063 srtB_target sortase   20.1 1.4E+02   0.003   14.9   2.4   12    7-18     10-21  (29)
 70 KOG1225 Teneurin-1 and related  20.1      33 0.00072   27.7  -0.1   27   31-64    298-325 (525)

No 1  
>PF07333 SLR1-BP:  S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP);  InterPro: IPR010851 This entry consists of a number of cysteine rich SLR1 binding pollen coat like proteins. Adhesion of pollen grains to the stigmatic surface is a critical step during sexual reproduction in plants. In Brassica, S locus-related glycoprotein 1 (SLR1), a stigma-specific protein belonging to the S gene family of proteins, has been shown to be involved in this step. SLR1-BP specifically binds SLR1 with high affinity. The SLR1-BP gene is specifically expressed in pollen at late stages of development and is a member of the class A pollen coat protein (PCP) family, which includes PCP-A1, an SLG (S locus glycoprotein)-binding protein [].  This entry also includes defensin-like proteins. The function of these proteins is uncharacterised.
Probab=99.69  E-value=2.8e-17  Score=94.98  Aligned_cols=54  Identities=33%  Similarity=0.837  Sum_probs=46.9

Q ss_pred             hhhhcccccccccccc---ccCChhhHHHHhHhhccCCCee-eEEeeCCCCCCcceeEeecC
Q 040193           23 VRRVDAQVKRCEEKSN---PNCSLEDCRAKCINKYINKRGF-GECIENGAHTGYDCYCFWDC   80 (80)
Q Consensus        23 ~~~~qg~~~~C~~~i~---~~C~~~~C~~~C~~k~~~~~G~-G~C~~~~~~~~~~C~C~Y~C   80 (80)
                      |+|+|||+.+|+++|+   ++|+.++|+++|.++|   +|. |+|+++ ++++.+|+|+|+|
T Consensus         1 ~~etqg~~~~C~~~l~~~~~~C~~~~C~~~C~~k~---~g~~G~C~~~-~~~~~~C~C~Y~C   58 (58)
T PF07333_consen    1 VKETQGQERQCHEVLPNKPGPCDPQDCRSLCKKKY---KGGVGTCIPK-PKGPKQCLCTYNC   58 (58)
T ss_pred             CCcccCCCCcCceeCccCCCCCChHHHHHHHHHHc---CCCceEeccC-CCCCCeeEEEeeC
Confidence            5899999556999998   6899999999999999   665 999993 3468899999998


No 2  
>PF10868 DUF2667:  Protein of unknown function (DUF2667);  InterPro: IPR022618  This family of proteins with unknown function appears to be restricted to Arabidopsis thaliana. 
Probab=97.97  E-value=1e-05  Score=50.87  Aligned_cols=73  Identities=29%  Similarity=0.506  Sum_probs=46.6

Q ss_pred             hhhHHHHHHHHHHHHHHHhhhhhhccccccccccccccCCh--hhHHHHhHhhccCCCeeeEEeeCC-CCCCcceeEeec
Q 040193            3 KLSFNNIFVFLLILSAALMAVRRVDAQVKRCEEKSNPNCSL--EDCRAKCINKYINKRGFGECIENG-AHTGYDCYCFWD   79 (80)
Q Consensus         3 K~s~~~~~i~~lvls~~~~~~~~~qg~~~~C~~~i~~~C~~--~~C~~~C~~k~~~~~G~G~C~~~~-~~~~~~C~C~Y~   79 (80)
                      |+|..+|+ +++.+|+++..-.|..|+ ..|..-+ ..|+.  .+|+..|.+-.++ ..-|.|.+.. +++...|.|-|+
T Consensus         5 k~st~~il-vvvclsiLLisp~eV~G~-~~cd~~~-G~C~~~~~~C~~~Ck~~~~~-y~GG~C~~~~~~~~~~~C~Cc~~   80 (90)
T PF10868_consen    5 KLSTFVIL-VVVCLSILLISPTEVDGR-LKCDSPF-GACTPFSSDCNEPCKKFGSN-YYGGQCVPVGPPPGDGVCYCCYY   80 (90)
T ss_pred             EEEeeehh-HHHHHHHHccccceeCCe-EccCccc-ccCCchHHHHHHHHHhhccC-CCCceeccCCCCCCCcEEEEecc
Confidence            66766665 455557655312346776 4566322 67887  7899999963321 2339999954 346678999885


No 3  
>PF00451 Toxin_2:  Scorpion short toxin, BmKK2;  InterPro: IPR001947 Scorpion venoms contain a variety of peptides toxic to mammals, insects and crustaceans. Among these peptides there is a family of short toxins (30 to 40 residues) [, ] including charybdotoxin, kaliotoxin [], noxiustoxin [] and iberiotoxin [, ]. Charybdotoxin consists of a single polypeptide chain and is a potent, selective inhibitor of calcium-activated potassium channels in pituitary and aortic smooth muscle cells - the toxin reversibly blocks channel activity by interacting at the external pore of the channel protein[]. The tertiary structure of the toxins comprises a 3-stranded beta-sheet and a short helix, and is stabilised by a number of disulphide bridges [] as shown in the following schematic representation:  +---------------------+ | | | | xxxxxxxCxxxxxCxxxCxxxxxxxxxxxCxxxxCxCxxx | | | | | +----------------+ | +----------------------+ 'C': conserved cysteine involved in a disulphide bond.  ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 1TSK_A 2PTA_A 1BIG_A 3ODV_A 2UVS_A 2KTX_A 1XSW_A 1KTX_A 1WMT_A 1PNH_A ....
Probab=90.64  E-value=0.67  Score=23.81  Aligned_cols=29  Identities=28%  Similarity=0.840  Sum_probs=23.4

Q ss_pred             CC-hhhHHHHhHhhccCCCeeeEEeeCCCCCCcceeEe
Q 040193           41 CS-LEDCRAKCINKYINKRGFGECIENGAHTGYDCYCF   77 (80)
Q Consensus        41 C~-~~~C~~~C~~k~~~~~G~G~C~~~~~~~~~~C~C~   77 (80)
                      |. +.+|..-|.+.+  +.-.|.|++.      .|.|+
T Consensus         3 C~~s~~C~~~Ck~~~--g~~~gKCmN~------kC~Cy   32 (32)
T PF00451_consen    3 CTGSKDCWPPCKKAT--GCLNGKCMNG------KCKCY   32 (32)
T ss_dssp             TSSHHHHHHHHHHHT--SSSEEEEETT------EEEEE
T ss_pred             cCCchHHHHHhhhhh--CCCCCCccCC------CceeC
Confidence            66 478999999998  4567999987      68885


No 4  
>PF07127 Nodulin_late:  Late nodulin protein;  InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein. ENOD3 is expressed in the late stages of root nodule formation and contains two pairs of cysteine residues toward the proteins C terminus which may be involved in metal-binding [].; GO: 0046872 metal ion binding, 0009878 nodule morphogenesis
Probab=90.38  E-value=0.35  Score=27.07  Aligned_cols=25  Identities=36%  Similarity=0.472  Sum_probs=14.9

Q ss_pred             CchhhHHHHHHHHHHHHHHHhhhhhhc
Q 040193            1 MAKLSFNNIFVFLLILSAALMAVRRVD   27 (80)
Q Consensus         1 MaK~s~~~~~i~~lvls~~~~~~~~~q   27 (80)
                      |||+.-.. ++++|+||.|++ +...+
T Consensus         1 Ma~ilKFv-Y~mIiflslflv-~~~~~   25 (54)
T PF07127_consen    1 MAKILKFV-YAMIIFLSLFLV-VTNVD   25 (54)
T ss_pred             CccchhhH-HHHHHHHHHHHh-hcccC
Confidence            88776643 444566677787 34443


No 5  
>PF00304 Gamma-thionin:  Gamma-thionin family;  InterPro: IPR008176 The following small plant proteins are evolutionary related:  Gamma-thionins from Triticum aestivum (Wheat) endosperm (gamma-purothionins) and gamma-hordothionins from Hordeum vulgare(Barley) are toxic to animal cells and inhibit protein synthesis in cell free systems []. A flower-specific thionin (FST) from Nicotiana tabacum (Common Tobacco)[]. Antifungal proteins (AFP) from the seeds of Brassicaceae species such as radish, mustard, turnip and Arabidopsis thaliana (Thale Cress)[]. Inhibitors of insect alpha-amylases from sorghum []. Probable protease inhibitor P322 from Solanum tuberosum (Potato). A germination-related protein from Vigna unguiculata (Cowpea) []. Anther-specific protein SF18 from sunflower. SF18 is a protein that contains a gamma-thionin domain at its N terminus and a proline-rich C-terminal domain.  Glycine max (Soybean) sulphur-rich protein SE60 [].  Vicia faba (Broad bean) antibacterial peptides fabatin-1 and -2.  In their mature form, these proteins generally consist of about 45 to 50 amino-acid residues. As shown in the following schematic representation, these peptides contain eight conserved cysteines involved in disulphide bonds.  +-------------------------------------------+ | +-------------------+ | | | | | xxCxxxxxxxxxxCxxxxxCxxxCxxxxxxxxxCxxxxxxCxCxxxC | | | | +---|----------------+ | +------------------+ 'C': conserved cysteine involved in a disulphide bond.  The folded structure of Gamma-purothionin is characterised by a well-defined 3-stranded anti-parallel beta-sheet and a short alpha-helix []. Three disulphide bridges are located in the hydrophobic core between the helix and sheet, forming a cysteine-stabilised alpha-helical motif. This structure differs from that of the plant alpha- and beta- thionins, but is analogous to scorpion toxins and insect defensins.; GO: 0006952 defense response; PDB: 4AB0_A 4AAZ_B 1N4N_A 2KPY_A 1JKZ_A 1AYJ_A 1GPT_A 1BK8_A 2GL1_A 1GPS_A ....
Probab=88.91  E-value=0.75  Score=25.08  Aligned_cols=35  Identities=29%  Similarity=0.599  Sum_probs=25.9

Q ss_pred             ccCCh-hhHHHHhHhhccCCCeeeEEeeCCCCCCcceeEeecC
Q 040193           39 PNCSL-EDCRAKCINKYINKRGFGECIENGAHTGYDCYCFWDC   80 (80)
Q Consensus        39 ~~C~~-~~C~~~C~~k~~~~~G~G~C~~~~~~~~~~C~C~Y~C   80 (80)
                      ..|-. +.|+..|.++-   ..-|.|...    ...|+|+++|
T Consensus        12 G~C~~~~~C~~~C~~eg---~~~G~C~~~----~~~C~C~~~C   47 (47)
T PF00304_consen   12 GLCFSDSNCANVCINEG---FTGGKCSGP----LRRCFCTKPC   47 (47)
T ss_dssp             SS-SSHHHHHHHHHHCT---SSEEEEETT----TTEEEEEEEE
T ss_pred             eECCCcchhhHHhccCC---CCCCEeCCC----CceEEEeCcC
Confidence            45754 67999999876   457999963    2479999987


No 6  
>PF12606 RELT:  Tumour necrosis factor receptor superfamily member 19;  InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis).  RELT (receptor expressed in lymphoid tissues) is a member of the TNFR superfamily. The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1 []. RELT like proteins 1 and 2 (RELL1 and RELL2) are two RELT homologues that bind to RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues [].
Probab=88.64  E-value=0.74  Score=25.93  Aligned_cols=34  Identities=9%  Similarity=0.168  Sum_probs=20.9

Q ss_pred             CchhhHHHHHHHHHHHHHHHhhhhhhcccccccccc
Q 040193            1 MAKLSFNNIFVFLLILSAALMAVRRVDAQVKRCEEK   36 (80)
Q Consensus         1 MaK~s~~~~~i~~lvls~~~~~~~~~qg~~~~C~~~   36 (80)
                      |..+....||+++.||++.+..+.++.|.  +|+.-
T Consensus         1 y~~~~iV~i~iv~~lLg~~I~~~~K~ygY--kht~d   34 (50)
T PF12606_consen    1 YIAFLIVSIFIVMGLLGLSICTTLKAYGY--KHTVD   34 (50)
T ss_pred             CeehHHHHHHHHHHHHHHHHHHHhhcccc--ccccC
Confidence            44455566666677776655546777775  66543


No 7  
>PF11415 Toxin_37:  Antifungal peptide termicin;  InterPro: IPR024723 Termicin is a cysteine-rich antifungal peptide, which also exhibits weak antibacterial activity. The global fold of termicin consists of an alpha-helical segment and a two-stranded antiparallel beta-sheet forming a cysteine stabilised alphabeta motif that is also found in antibacterial and antifungal defensins from insects and from plants. The antifungal properties of termicin may be related to its marked hydrophobicity and its amphipatic structure compared to the antibacterial defensins [].; PDB: 1MM0_A.
Probab=87.54  E-value=1.2  Score=23.34  Aligned_cols=33  Identities=21%  Similarity=0.538  Sum_probs=20.5

Q ss_pred             CChhhHHHHhHhhccCCCeeeEEeeCCCCCCcceeEeec
Q 040193           41 CSLEDCRAKCINKYINKRGFGECIENGAHTGYDCYCFWD   79 (80)
Q Consensus        41 C~~~~C~~~C~~k~~~~~G~G~C~~~~~~~~~~C~C~Y~   79 (80)
                      |+.++|.+.|..+|--.=--.-|..+      .|.|.|+
T Consensus         1 C~~~~CWa~CqaqhgiyFRRAyCdGs------~C~Cvf~   33 (35)
T PF11415_consen    1 CDFQSCWANCQAQHGIYFRRAYCDGS------RCKCVFN   33 (35)
T ss_dssp             --HHHHHHHHHHHS-TTEEEEEEETT------EEEEEE-
T ss_pred             CcHHHHHHHHHHhhcchhhhhhccCC------eeEEEec
Confidence            78899999999998100023456554      6999874


No 8  
>PF15240 Pro-rich:  Proline-rich
Probab=86.75  E-value=0.34  Score=33.87  Aligned_cols=19  Identities=32%  Similarity=0.590  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHhhhhhhccc
Q 040193           11 VFLLILSAALMAVRRVDAQ   29 (80)
Q Consensus        11 i~~lvls~~~~~~~~~qg~   29 (80)
                      ||++||+|+|.|++.||..
T Consensus         1 MLlVLLSvALLALSSAQ~~   19 (179)
T PF15240_consen    1 MLLVLLSVALLALSSAQST   19 (179)
T ss_pred             ChhHHHHHHHHHhhhcccc
Confidence            5566667766667777753


No 9  
>PF02402 Lysis_col:  Lysis protein;  InterPro: IPR003059 The DNA sequence of the entire colicin E2 operon has been determined []. The operon comprises the colicin activity gene (ceaB), the colicin immunity gene (ceiB) and the lysis gene (celB), which is essential for colicin release from producing cells []. A putative LexA binding site is located upstream from ceaB, and a rho-independent terminator structure is located downstream from celB []. Comparison of the amino acid sequences of colicin E2 and cloacin DF13 reveal extensive similarity. These colicins have different modes of action and recognise different cell surface receptors; the two major regions of heterology at the C terminus, and in the C-terminal end of the central region are thought to correspond to the catalytic and receptor-recognition domains, respectively [].  Sequence similarities between colicins E2, A and E1 [] are less striking. The colicin E2 (pyocin) immunity protein does not share similarity with either the colicin E3 or cloacin DF13 [] immunity proteins. By contrast, the lysis proteins of the ColE2, ColE1 and CloDF13 plasmids are almost identical except in the N-terminal regions, which themselves are similar to lipoprotein signal peptides []. Processing of the ColE2 prolysis protein to the mature form is prevented by globomycin, a specific inhibitor of the lipoprotein signal peptidase []. The mature ColE2 lysis protein is located in the cell envelope [].; GO: 0009405 pathogenesis, 0019835 cytolysis, 0019867 outer membrane
Probab=74.88  E-value=1.5  Score=24.29  Aligned_cols=18  Identities=39%  Similarity=0.728  Sum_probs=13.8

Q ss_pred             CchhhHHHHHHHHHHHHH
Q 040193            1 MAKLSFNNIFVFLLILSA   18 (80)
Q Consensus         1 MaK~s~~~~~i~~lvls~   18 (80)
                      |-|+.++.||+++++|++
T Consensus         1 MkKi~~~~i~~~~~~L~a   18 (46)
T PF02402_consen    1 MKKIIFIGIFLLTMLLAA   18 (46)
T ss_pred             CcEEEEeHHHHHHHHHHH
Confidence            678888888887776664


No 10 
>smart00505 Knot1 Knottins. Knottins, representing plant lectins/antimicrobial peptides, plant proteinase/amylase inhibitors, plant gamma-thionins and arthropod defensins.
Probab=71.07  E-value=4.1  Score=21.33  Aligned_cols=33  Identities=27%  Similarity=0.586  Sum_probs=23.0

Q ss_pred             ccCChh--hHHHHhHhhccCCCeeeEEeeCCCCCCcceeEee
Q 040193           39 PNCSLE--DCRAKCINKYINKRGFGECIENGAHTGYDCYCFW   78 (80)
Q Consensus        39 ~~C~~~--~C~~~C~~k~~~~~G~G~C~~~~~~~~~~C~C~Y   78 (80)
                      .+|..+  .|+..|.++.   ...|.|...    ...|.|.+
T Consensus        11 g~C~~~~~~C~~~C~~~g---~~~G~C~~~----~~~C~C~~   45 (45)
T smart00505       11 GNCKSSCALCAKLCKKKG---AKGGYCRGT----TRRCFCYK   45 (45)
T ss_pred             CCccCCchHhHHHhhhcC---CCCCCcCCc----CCceEeeC
Confidence            457765  6999999864   345899653    23699864


No 11 
>PHA03072 putative viral membrane protein; Provisional
Probab=66.22  E-value=5.8  Score=27.95  Aligned_cols=20  Identities=40%  Similarity=0.461  Sum_probs=16.5

Q ss_pred             chhhHHHHHHHHHHHHHHHh
Q 040193            2 AKLSFNNIFVFLLILSAALM   21 (80)
Q Consensus         2 aK~s~~~~~i~~lvls~~~~   21 (80)
                      ||.|...||+++|++|+++.
T Consensus        27 a~~sTl~ff~l~L~iS~llf   46 (190)
T PHA03072         27 AKTSTLIFFVIILAISVLLL   46 (190)
T ss_pred             hhhhhHHHHHHHHHHHHHHH
Confidence            57788899999998888665


No 12 
>PF03356 Pox_LP_H2:  Viral late protein H2;  InterPro: IPR005023 This entry represents the late protein H2 found in Vaccinia and other poxviruses. This protein is a highly conserved viral membrane protein found in all sequenced poxviruses, containing an N-terminal transmembrane domain and four conserved cysteines thought to be involved in the formation of intramolecular disulphide bonds []. H2 has been shown to be necessary for entry into the host cell and virus-induced cell-cell fusion, but is not required for virus morphogenesis or the attachment of virus particles to cells. It is part of an entry-fusion complex composed of eight viral membrane proteins [].
Probab=63.02  E-value=6.9  Score=27.56  Aligned_cols=20  Identities=45%  Similarity=0.605  Sum_probs=16.4

Q ss_pred             chhhHHHHHHHHHHHHHHHh
Q 040193            2 AKLSFNNIFVFLLILSAALM   21 (80)
Q Consensus         2 aK~s~~~~~i~~lvls~~~~   21 (80)
                      ||-|.+.||+++|.+|+++.
T Consensus        27 ak~sTl~ffvlil~iS~llf   46 (189)
T PF03356_consen   27 AKVSTLCFFVLILIISVLLF   46 (189)
T ss_pred             hcchhHHHHHHHHHHHHHHH
Confidence            57788899998998888665


No 13 
>PF11714 Inhibitor_I53:  Thrombin inhibitor Madanin  ;  InterPro: IPR021716  Members of this family are the peptidase inhibitor madanin proteins. These proteins were isolated from tick saliva []. 
Probab=62.31  E-value=8.8  Score=23.26  Aligned_cols=20  Identities=25%  Similarity=0.331  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHHhhhhhh
Q 040193            7 NNIFVFLLILSAALMAVRRV   26 (80)
Q Consensus         7 ~~~~i~~lvls~~~~~~~~~   26 (80)
                      ++|+|+..|+|+.+||-.+.
T Consensus         4 FaiLilavVaSAvVMAyPe~   23 (78)
T PF11714_consen    4 FAILILAVVASAVVMAYPER   23 (78)
T ss_pred             HHHHHHHHHHHHHHHhcccc
Confidence            35677777788888855543


No 14 
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=59.66  E-value=5.4  Score=18.12  Aligned_cols=10  Identities=50%  Similarity=0.750  Sum_probs=4.6

Q ss_pred             HHHHHHHHHH
Q 040193            8 NIFVFLLILS   17 (80)
Q Consensus         8 ~~~i~~lvls   17 (80)
                      +|++++|++|
T Consensus         6 IIlvvLLliS   15 (19)
T PF13956_consen    6 IILVVLLLIS   15 (19)
T ss_pred             HHHHHHHhcc
Confidence            3444445444


No 15 
>PHA02291 hypothetical protein
Probab=58.17  E-value=12  Score=24.60  Aligned_cols=17  Identities=29%  Similarity=0.374  Sum_probs=11.9

Q ss_pred             Cc-hhhHHHHHHHHHHHH
Q 040193            1 MA-KLSFNNIFVFLLILS   17 (80)
Q Consensus         1 Ma-K~s~~~~~i~~lvls   17 (80)
                      |+ |.|+.++++++++++
T Consensus         1 MS~K~~iFYiL~~~VL~~   18 (132)
T PHA02291          1 MSRKASIFYILVVIVLAF   18 (132)
T ss_pred             CCcchhhHHHHHHHHHHH
Confidence            55 778888877666654


No 16 
>PF04202 Mfp-3:  Foot protein 3;  InterPro: IPR007328 Mytilus foot protein-3 (Mfp-3) is a highly polymorphic protein family located in the byssal adhesive plaques of blue mussels.
Probab=57.41  E-value=9  Score=22.96  Aligned_cols=15  Identities=33%  Similarity=0.583  Sum_probs=10.3

Q ss_pred             CchhhHHHHHHHHHH
Q 040193            1 MAKLSFNNIFVFLLI   15 (80)
Q Consensus         1 MaK~s~~~~~i~~lv   15 (80)
                      |-++|+..++.|+|+
T Consensus         1 mnn~Si~VLlaLvLI   15 (71)
T PF04202_consen    1 MNNLSIAVLLALVLI   15 (71)
T ss_pred             CCchhHHHHHHHHHH
Confidence            677888776665554


No 17 
>PHA03255 BDLF3; Provisional
Probab=56.70  E-value=10  Score=26.94  Aligned_cols=15  Identities=27%  Similarity=0.676  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHH-HHhh
Q 040193            8 NIFVFLLILSA-ALMA   22 (80)
Q Consensus         8 ~~~i~~lvls~-~~~~   22 (80)
                      -|+||+|+|.+ +||+
T Consensus       193 tflmlilifaagimma  208 (234)
T PHA03255        193 TFLMLILIFAAGLMMS  208 (234)
T ss_pred             HHHHHHHHHHhhHhhh
Confidence            46777888854 4553


No 18 
>cd00107 Knot1 The "knottin" fold is stable cysteine-rich scaffold, in which one disulfide bridge crosses the macrocycle made by two other disulfide bridges and the connecting backbone segments. Members include plant lectins/antimicrobial peptides, plant proteinase/amylase inhibitors, plant gamma-thionins, and arthropod defensins.
Probab=56.24  E-value=13  Score=18.41  Aligned_cols=30  Identities=30%  Similarity=0.812  Sum_probs=20.5

Q ss_pred             CCh-hhHHHHhHhhccCCCeeeEEeeCCCCCCcceeEe
Q 040193           41 CSL-EDCRAKCINKYINKRGFGECIENGAHTGYDCYCF   77 (80)
Q Consensus        41 C~~-~~C~~~C~~k~~~~~G~G~C~~~~~~~~~~C~C~   77 (80)
                      |.. +.|+..|.++.   ...|.|...    ...|.|.
T Consensus         3 C~~~~~C~~~Ck~~g---~~~G~C~~~----~~~C~C~   33 (33)
T cd00107           3 CFSDSYCDKECKKKG---ASGGYCYGQ----GLACWCY   33 (33)
T ss_pred             CCCchhHHHHHhHcC---CCccEeCCC----CCeEEeC
Confidence            544 56999999763   445999753    2368884


No 19 
>COG2991 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.93  E-value=10  Score=23.05  Aligned_cols=18  Identities=22%  Similarity=0.645  Sum_probs=9.2

Q ss_pred             cccccccc----ccCChhhHHHHhH
Q 040193           31 KRCEEKSN----PNCSLEDCRAKCI   51 (80)
Q Consensus        31 ~~C~~~i~----~~C~~~~C~~~C~   51 (80)
                      ..|--+-.    +.||   |...|.
T Consensus        31 GSCGGi~alGi~K~Cd---C~~pCD   52 (77)
T COG2991          31 GSCGGIAALGIEKVCD---CDEPCD   52 (77)
T ss_pred             cccccHHhhccchhcC---CCCchH
Confidence            45654433    5566   455554


No 20 
>PF05294 Toxin_5:  Scorpion short toxin;  InterPro: IPR007958 This family contains various secreted scorpion short toxins which seem to be unrelated to those described in IPR001947 from INTERPRO.; GO: 0009405 pathogenesis, 0005576 extracellular region; PDB: 1SIS_A 1CHL_A.
Probab=54.02  E-value=15  Score=18.79  Aligned_cols=20  Identities=40%  Similarity=1.185  Sum_probs=13.4

Q ss_pred             hhHHHHhHhhccCCCeeeEEeeCCCCCCcceeE
Q 040193           44 EDCRAKCINKYINKRGFGECIENGAHTGYDCYC   76 (80)
Q Consensus        44 ~~C~~~C~~k~~~~~G~G~C~~~~~~~~~~C~C   76 (80)
                      .+|+.=|       .|.|+|..+      +|+|
T Consensus        13 ~kC~~CC-------gg~GkC~Gp------qClC   32 (32)
T PF05294_consen   13 KKCRDCC-------GGRGKCFGP------QCLC   32 (32)
T ss_dssp             HHHHHHC-------TTSEEEETT------EEEE
T ss_pred             HHHHHHh-------CCCCeEcCC------cccC
Confidence            4555555       355999875      7887


No 21 
>PF10828 DUF2570:  Protein of unknown function (DUF2570);  InterPro: IPR022538 This entry is represented by Bacteriophage IME08, pseT.3. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  This is a family of proteins with unknown function. 
Probab=52.14  E-value=20  Score=22.57  Aligned_cols=21  Identities=29%  Similarity=0.300  Sum_probs=14.2

Q ss_pred             CchhhHHHHHHHHHHHHHHHh
Q 040193            1 MAKLSFNNIFVFLLILSAALM   21 (80)
Q Consensus         1 MaK~s~~~~~i~~lvls~~~~   21 (80)
                      |+|.....+.+|+++|++++.
T Consensus         1 ~~~~~~~~l~~lvl~L~~~l~   21 (110)
T PF10828_consen    1 MKKYIYIALAVLVLGLGGWLW   21 (110)
T ss_pred             ChHHHHHHHHHHHHHHHHHHH
Confidence            777777776666666666554


No 22 
>PF01097 Defensin_2:  Arthropod defensin;  InterPro: IPR001542 Arthropod defensins are a family of insect and scorpion cysteine-rich antibacterial peptides, primarily active against Gram-positive bacteria [, , , , ]. All these peptides range in length from 38 to 51 amino acids. There are six conserved cysteines all involved in intrachain disulphide bonds. A schematic representation of peptides from the arthropod defensin family is shown below.  +----------------------------+ | | xxCxxxxxxxxxxxxxxCxxxCxxxxxxxxxCxxxxxCxCxx | | | | +---|---------------+ | +-----------------+ 'C': conserved cysteine involved in a disulphide bond.   Although low level sequence similarities have been reported [] between the arthropod defensins and mammalian defensins, the topological arrangement of the disulphide bonds as well as the tertiary structure [] are completely different in the two families.; GO: 0006952 defense response; PDB: 1FJN_A 1ICA_A 1L4V_A 2LLD_A 3E7R_L 3E7U_X 1ZFU_A 2B68_A 2NZ3_A 2NY8_X ....
Probab=52.12  E-value=33  Score=17.63  Aligned_cols=27  Identities=33%  Similarity=0.674  Sum_probs=20.0

Q ss_pred             hhhHHHHhHhhccCCCeeeEEeeCCCCCCcceeEe
Q 040193           43 LEDCRAKCINKYINKRGFGECIENGAHTGYDCYCF   77 (80)
Q Consensus        43 ~~~C~~~C~~k~~~~~G~G~C~~~~~~~~~~C~C~   77 (80)
                      ...|.+.|..+-  ..| |-|...     ..|.|+
T Consensus         8 ~~~C~~hC~~~g--~~G-GyC~~~-----~vC~Cr   34 (34)
T PF01097_consen    8 HSACAAHCLSIG--YRG-GYCNGK-----GVCVCR   34 (34)
T ss_dssp             CHHHHHHHHHHT--CSE-EEEETT-----SCEEEE
T ss_pred             HHHHHHHHHHhC--Ccc-eeCCCC-----CEEEeC
Confidence            467999999886  245 999863     378885


No 23 
>PF14147 Spore_YhaL:  Sporulation protein YhaL
Probab=50.76  E-value=20  Score=20.36  Aligned_cols=20  Identities=15%  Similarity=0.198  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHHHhhhhhhc
Q 040193            7 NNIFVFLLILSAALMAVRRVD   27 (80)
Q Consensus         7 ~~~~i~~lvls~~~~~~~~~q   27 (80)
                      .|+.++-+++|++|. ++-+.
T Consensus         5 vY~vi~gI~~S~ym~-v~t~~   24 (52)
T PF14147_consen    5 VYFVIAGIIFSGYMA-VKTAK   24 (52)
T ss_pred             HHHHHHHHHHHHHHH-HHHHH
Confidence            467777788899887 55443


No 24 
>PLN00214 putative protein; Provisional
Probab=49.11  E-value=7.8  Score=25.37  Aligned_cols=28  Identities=25%  Similarity=0.561  Sum_probs=14.4

Q ss_pred             Cchhh--HHHHHHHHHHHHHHH--hhhhhhcc
Q 040193            1 MAKLS--FNNIFVFLLILSAAL--MAVRRVDA   28 (80)
Q Consensus         1 MaK~s--~~~~~i~~lvls~~~--~~~~~~qg   28 (80)
                      |||++  .+.+||++-++-+|+  .++++++.
T Consensus         1 m~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~   32 (115)
T PLN00214          1 MSKFSSQITTLFIVVALVCAFVPVFSVEEAEA   32 (115)
T ss_pred             CCccccchhHHHHHHHHHHhcccccchhhhHH
Confidence            77766  445555554444432  12466654


No 25 
>CHL00020 psbN photosystem II protein N
Probab=47.93  E-value=23  Score=19.37  Aligned_cols=18  Identities=28%  Similarity=0.364  Sum_probs=12.7

Q ss_pred             CchhhHHHHHHHHHHHHH
Q 040193            1 MAKLSFNNIFVFLLILSA   18 (80)
Q Consensus         1 MaK~s~~~~~i~~lvls~   18 (80)
                      |.-.+.+.|||..|++|+
T Consensus         1 me~A~~~~i~i~~ll~~~   18 (43)
T CHL00020          1 METATLVAIFISGLLVSF   18 (43)
T ss_pred             CCchhhHHHHHHHHHHHh
Confidence            555667778887777763


No 26 
>PF03929 PepSY_TM:  PepSY-associated TM helix;  InterPro: IPR005625  This domain represents a conserved transmembrane (TM) helix that is found in bacterial proteins. Coil residues are significantly more conserved than other residues and are frequently found within channels and transporters, where they introduce the flexibility and polarity required for transport across the membrane []. This TM helix associates with PepSY (peptidase (M4) and YpeB of subtilis). PepSY is a repeated region first identified in Thermoanaerobacter tengcongensis. The PepSY domain functions in the control of M4 peptidases through their propeptide and in the germination of spores. It may also play a part in regulating protease activity [].
Probab=45.18  E-value=33  Score=16.70  Aligned_cols=13  Identities=8%  Similarity=0.427  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHHHH
Q 040193            7 NNIFVFLLILSAA   19 (80)
Q Consensus         7 ~~~~i~~lvls~~   19 (80)
                      ++++++++.+++.
T Consensus        12 ~al~~lv~~iTGl   24 (27)
T PF03929_consen   12 FALFMLVFAITGL   24 (27)
T ss_pred             HHHHHHHHHHHHH
Confidence            4455555555544


No 27 
>TIGR01606 holin_BlyA holin, BlyA family. This family represents a BlyA, a small holin found in Borrelia circular plasmids that prove to be temperate phage. This protein was previously proposed to be an hemolysin. BlyA is small (67 residues) and contains two largely hydrophobic helices and a highly charged C-terminus.
Probab=42.23  E-value=38  Score=19.89  Aligned_cols=20  Identities=40%  Similarity=0.471  Sum_probs=14.5

Q ss_pred             chhhHHHHHHHHHHHHHHHh
Q 040193            2 AKLSFNNIFVFLLILSAALM   21 (80)
Q Consensus         2 aK~s~~~~~i~~lvls~~~~   21 (80)
                      +|+....+|+.++++++.+.
T Consensus        16 iklI~lmifi~~~IL~~~l~   35 (63)
T TIGR01606        16 IKLIKLMIFISIFILSLGLI   35 (63)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            36667778888888886654


No 28 
>PRK13183 psbN photosystem II reaction center protein N; Provisional
Probab=41.22  E-value=36  Score=18.83  Aligned_cols=18  Identities=17%  Similarity=0.198  Sum_probs=11.6

Q ss_pred             CchhhHHHHHHHHHHHHH
Q 040193            1 MAKLSFNNIFVFLLILSA   18 (80)
Q Consensus         1 MaK~s~~~~~i~~lvls~   18 (80)
                      |.-.+.+.|||..|++|+
T Consensus         4 me~A~~~~i~i~~lL~~~   21 (46)
T PRK13183          4 MSPALSLAITILAILLAL   21 (46)
T ss_pred             cchhHHHHHHHHHHHHHH
Confidence            444566677777777763


No 29 
>COG3771 Predicted membrane protein [Function unknown]
Probab=40.72  E-value=27  Score=22.06  Aligned_cols=14  Identities=36%  Similarity=0.764  Sum_probs=9.1

Q ss_pred             HHHHHHHHHHHHHh
Q 040193            8 NIFVFLLILSAALM   21 (80)
Q Consensus         8 ~~~i~~lvls~~~~   21 (80)
                      ||+++++||.+|++
T Consensus         3 yil~~vlvlaifli   16 (97)
T COG3771           3 YILIFVLVLAIFLI   16 (97)
T ss_pred             hHHHHHHHHHHHHH
Confidence            56666777766665


No 30 
>PF08027 Albumin_I:  Albumin I;  InterPro: IPR012512 The albumin I protein, a hormone-like peptide, stimulates kinase activity upon binding a membrane bound 43 kDa receptor. The structure of this region reveals a knottin like fold, comprise of three beta strands [].; GO: 0045735 nutrient reservoir activity, 0009405 pathogenesis; PDB: 1P8B_A 1JU8_A.
Probab=40.54  E-value=12  Score=24.72  Aligned_cols=30  Identities=37%  Similarity=0.622  Sum_probs=16.0

Q ss_pred             cccccccccCChhhHHHHhHhhccCCCeeeEEeeC
Q 040193           32 RCEEKSNPNCSLEDCRAKCINKYINKRGFGECIEN   66 (80)
Q Consensus        32 ~C~~~i~~~C~~~~C~~~C~~k~~~~~G~G~C~~~   66 (80)
                      .|...-.++|...+|+  |....   -=+|.|+..
T Consensus        25 ~Cs~Fe~ppCgss~Cr--CiP~~---l~~G~C~~p   54 (120)
T PF08027_consen   25 VCSPFEMPPCGSSDCR--CIPWG---LFVGFCIYP   54 (120)
T ss_dssp             EE-TTSSSCCC-TTSE--EEE-S---SS-EEEE-T
T ss_pred             cccCCcCCCCCCCCee--EEEee---ecceEEECC
Confidence            3443322679988898  86433   346889874


No 31 
>KOG4063 consensus Major epididymal secretory protein HE1 [Function unknown]
Probab=37.10  E-value=45  Score=22.96  Aligned_cols=40  Identities=28%  Similarity=0.517  Sum_probs=22.5

Q ss_pred             hhhHHHHHHHHHHHHHHHhhh--hhhcccccccccc----c--c-ccCChhhH
Q 040193            3 KLSFNNIFVFLLILSAALMAV--RRVDAQVKRCEEK----S--N-PNCSLEDC   46 (80)
Q Consensus         3 K~s~~~~~i~~lvls~~~~~~--~~~qg~~~~C~~~----i--~-~~C~~~~C   46 (80)
                      ++|+..+.+|.++||  +++.  .+++ - ++|-+.    .  . ++|+...|
T Consensus         2 ~ms~~~~v~l~alls--~a~aq~~~t~-~-k~C~ss~g~~~~V~i~~C~t~pC   50 (158)
T KOG4063|consen    2 MMSFLKTVILLALLS--LAAAQAISTG-V-KQCGSSDGTPLEVKIDGCPTTPC   50 (158)
T ss_pred             chHHHHHHHHHHHHH--HhhhcccCcc-c-ccccCCCCcceEEEecCCCCCce
Confidence            456767667677766  4411  1222 1 788873    1  1 77887744


No 32 
>PF10690 Myticin-prepro:  Myticin pre-proprotein from the mussel;  InterPro: IPR019631  Myticin is a cysteine-rich peptide produced in three isoforms, A, B and C, by Mytilus galloprovincialis (Mediterranean mussel). Isoforms A and B show antibacterial activity against Gram-positive bacteria, while isoform B is additionally active against the fungus Fusarium oxysporum and a Gram-negative bacterium, Escherichia coli (streptomycin resistant strain D31) []. Myticin-prepro is the precursor peptide. The mature molecule, named myticin, consists of 40 residues, with four intramolecular disulphide bridges and a cysteine array in the primary structure different from that of previously characterised cysteine-rich antimicrobial peptides. The first 20 amino acids are a putative signal peptide, and the antimicrobial peptide sequence is a 36-residue C-terminal extension. Such a structure suggests that myticins are synthesised as prepro-proteins that are then processed by various proteolytic events before storage in the haemocytes as the active peptide. Myticin precursors are expressed mainly in the haemocytes. ; PDB: 2EEM_A.
Probab=35.89  E-value=42  Score=21.32  Aligned_cols=32  Identities=13%  Similarity=0.346  Sum_probs=7.3

Q ss_pred             HHHHHHHHHhhhhhhccccccccccccccCChhhHHHHhHhhc
Q 040193           12 FLLILSAALMAVRRVDAQVKRCEEKSNPNCSLEDCRAKCINKY   54 (80)
Q Consensus        12 ~~lvls~~~~~~~~~qg~~~~C~~~i~~~C~~~~C~~~C~~k~   54 (80)
                      |.+++++++. +.|+|.+  .        |..--|...|....
T Consensus         7 LAv~vAViv~-v~ea~s~--~--------CtS~yC~~fCgsa~   38 (98)
T PF10690_consen    7 LAVVVAVIVG-VQEAQSI--S--------CTSYYCKKFCGSAR   38 (98)
T ss_dssp             -----------------------------HHHH-HHHHHHHTT
T ss_pred             cccccccccc-ccccccc--c--------cchhHHHHhcCCCC
Confidence            3445565565 6777753  2        44444666666554


No 33 
>PHA02706 hypothetical protein; Provisional
Probab=33.13  E-value=53  Score=18.64  Aligned_cols=16  Identities=19%  Similarity=0.364  Sum_probs=9.1

Q ss_pred             HHHHHHHHHHHHHHHh
Q 040193            6 FNNIFVFLLILSAALM   21 (80)
Q Consensus         6 ~~~~~i~~lvls~~~~   21 (80)
                      .+.|-|+|.+|++..+
T Consensus         7 llviaiimmllgi~si   22 (58)
T PHA02706          7 LLVIAIIMMLLGIASI   22 (58)
T ss_pred             hHHHHHHHHHHhhHHH
Confidence            3444555666676655


No 34 
>PF12729 4HB_MCP_1:  Four helix bundle sensory module for signal transduction;  InterPro: IPR024478 This entry represents a four-helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction, which is known as four-helix bundles methyl-accepting chemotaxis protein (4HB_MCP) domain. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterised in E coli chemoreceptors [].
Probab=32.70  E-value=52  Score=20.34  Aligned_cols=14  Identities=36%  Similarity=0.503  Sum_probs=6.6

Q ss_pred             hhhHHHHHHHHHHH
Q 040193            3 KLSFNNIFVFLLIL   16 (80)
Q Consensus         3 K~s~~~~~i~~lvl   16 (80)
                      |+...+++++++++
T Consensus         7 KL~~~f~~~~~l~~   20 (181)
T PF12729_consen    7 KLILGFGLIILLLL   20 (181)
T ss_pred             HHHHHHHHHHHHHH
Confidence            55555444444333


No 35 
>TIGR02209 ftsL_broad cell division protein FtsL. This model represents FtsL, both forms similar to that in E. coli and similar to that in B. subtilis. FtsL is one of the later proteins active in cell division septum formation. FtsL is small, low in complexity, and highly divergent. The scope of this model is broader than that of the Pfam model pfam04999.3 for FtsL, as this one includes FtsL from Bacillus subtilis and related species.
Probab=31.61  E-value=63  Score=18.71  Aligned_cols=6  Identities=33%  Similarity=0.169  Sum_probs=2.4

Q ss_pred             CchhhH
Q 040193            1 MAKLSF    6 (80)
Q Consensus         1 MaK~s~    6 (80)
                      |.++.+
T Consensus         1 ~~~l~~    6 (85)
T TIGR02209         1 EKKLYV    6 (85)
T ss_pred             CchHHH
Confidence            344333


No 36 
>COG5487 Small integral membrane protein [Function unknown]
Probab=31.07  E-value=60  Score=18.46  Aligned_cols=15  Identities=40%  Similarity=0.647  Sum_probs=7.4

Q ss_pred             chhhHHHHHHHHHHHH
Q 040193            2 AKLSFNNIFVFLLILS   17 (80)
Q Consensus         2 aK~s~~~~~i~~lvls   17 (80)
                      ||+.+.. |++++++|
T Consensus        31 AkIlF~i-~~vlf~vs   45 (54)
T COG5487          31 AKILFFI-FLVLFLVS   45 (54)
T ss_pred             HHHHHHH-HHHHHHHH
Confidence            4666544 33344445


No 37 
>PF05102 Holin_BlyA:  holin, BlyA family;  InterPro: IPR006493  This family is represented by BlyA, a small holin found in Borrelia circular plasmids that prove to be temperate phage []. This protein was previously proposed to be a haemolysin. BlyA is small (67 residues) and contains two largely hydrophobic helices and a highly charged C terminus. 
Probab=30.75  E-value=79  Score=18.48  Aligned_cols=19  Identities=37%  Similarity=0.537  Sum_probs=12.6

Q ss_pred             hhhHHHHHHHHHHHHHHHh
Q 040193            3 KLSFNNIFVFLLILSAALM   21 (80)
Q Consensus         3 K~s~~~~~i~~lvls~~~~   21 (80)
                      |+....+|+.++++++.+.
T Consensus        17 klI~~~ifI~v~IL~~iii   35 (61)
T PF05102_consen   17 KLIILMIFITVLILPLIII   35 (61)
T ss_pred             hhhHHHHHHHHHHHHHHHH
Confidence            5555657777777776554


No 38 
>PF08120 Toxin_32:  Tamulustoxin family;  InterPro: IPR012636 This family consists of the tamulustoxins, which are found in the venom of Mesobuthus tamulus (Eastern Indian scorpion) (Buthus tamulus). Tamulustoxin shares no similarity with other scorpion venom toxins, although the positions of its six cysteine residues suggest that it shares the same structural scaffold. Tamulustoxin acts as a potassium channel blocker [].; GO: 0019870 potassium channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region
Probab=30.30  E-value=7.8  Score=19.87  Aligned_cols=33  Identities=27%  Similarity=0.809  Sum_probs=20.9

Q ss_pred             CChhhHHHHhHhhccCCCeeeEEeeCCCCCCcceeEe
Q 040193           41 CSLEDCRAKCINKYINKRGFGECIENGAHTGYDCYCF   77 (80)
Q Consensus        41 C~~~~C~~~C~~k~~~~~G~G~C~~~~~~~~~~C~C~   77 (80)
                      |..-.|...|.+..|  .-.|+|+....  ...|.|.
T Consensus         2 chfvicttdcrrnsp--gtygecvkkek--gkecvck   34 (35)
T PF08120_consen    2 CHFVICTTDCRRNSP--GTYGECVKKEK--GKECVCK   34 (35)
T ss_pred             ceEEEeccccccCCC--Cchhhhhhhcc--Cccceec
Confidence            334456777777764  35789987532  3568874


No 39 
>PF02060 ISK_Channel:  Slow voltage-gated potassium channel;  InterPro: IPR000369 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. Two types of beta subunit (KCNE and KCNAB) are presently known to associate with voltage-gated alpha subunits (Kv, KCNQ and eag-like). However, not all combinations of alpha and beta subunits are possible. The KCNE family of K+ channel subunits are membrane glycoproteins that possess a single transmembrane (TM) domain. They share no structural relationship with the alpha subunit proteins, which possess pore forming domains. The subunits appear to have a regulatory function, modulating the kinetics and voltage dependence of the alpha subunits of voltage-dependent K+ channels. KCNE subunits are formed from short polypeptides of ~130 amino acids, and are divided into five subfamilies: KCNE1 (MinK/IsK), KCNE2 (MiRP1), KCNE3 (MiRP2), KCNE4 (MiRP3) and KCNE1L (AMMECR2). ; GO: 0005249 voltage-gated potassium channel activity, 0006811 ion transport, 0016020 membrane; PDB: 2K21_A.
Probab=30.25  E-value=45  Score=22.24  Aligned_cols=15  Identities=13%  Similarity=0.171  Sum_probs=7.8

Q ss_pred             hHHHHHHHHHHHHHH
Q 040193            5 SFNNIFVFLLILSAA   19 (80)
Q Consensus         5 s~~~~~i~~lvls~~   19 (80)
                      .++||+++|.++|.|
T Consensus        43 ~~lYIL~vmgfFgff   57 (129)
T PF02060_consen   43 EYLYILVVMGFFGFF   57 (129)
T ss_dssp             TT-HHHHHHHHHHHH
T ss_pred             eeehHHHHHHHHHHH
Confidence            355666655555544


No 40 
>PF09771 Tmemb_18A:  Transmembrane protein 188;  InterPro: IPR019168  The function of this family of transmembrane proteins has not, as yet, been determined. 
Probab=29.25  E-value=36  Score=22.51  Aligned_cols=20  Identities=30%  Similarity=0.474  Sum_probs=12.3

Q ss_pred             hhhcccc---cccccccc---ccCCh
Q 040193           24 RRVDAQV---KRCEEKSN---PNCSL   43 (80)
Q Consensus        24 ~~~qg~~---~~C~~~i~---~~C~~   43 (80)
                      +++.++.   .+|++++.   =.||.
T Consensus        86 krVvapsII~~R~R~vL~~fnmscd~  111 (125)
T PF09771_consen   86 KRVVAPSIIASRCRSVLADFNMSCDD  111 (125)
T ss_pred             hHhhCchHHHHHHHHHHhhhccCcCC
Confidence            4444443   68999887   24663


No 41 
>PF10794 DUF2606:  Protein of unknown function (DUF2606);  InterPro: IPR019730 This entry represents bacterial proteins with unknown function. 
Probab=29.16  E-value=43  Score=22.33  Aligned_cols=25  Identities=16%  Similarity=0.226  Sum_probs=16.5

Q ss_pred             hhhHHHHHHHHHHHHHHHhhhhhhc
Q 040193            3 KLSFNNIFVFLLILSAALMAVRRVD   27 (80)
Q Consensus         3 K~s~~~~~i~~lvls~~~~~~~~~q   27 (80)
                      |-|.+++|+.++++++-..+.++++
T Consensus        13 Ky~~~i~~l~i~~l~~c~~~~es~~   37 (131)
T PF10794_consen   13 KYSKLIWFLVIIVLCGCIANNESAA   37 (131)
T ss_pred             chhhHHHHHHHHHHhcccccchhhh
Confidence            5677788888888876555344444


No 42 
>PF11912 DUF3430:  Protein of unknown function (DUF3430);  InterPro: IPR021837  This family of proteins are functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 209 to 265 amino acids in length. 
Probab=29.09  E-value=52  Score=22.18  Aligned_cols=13  Identities=46%  Similarity=0.636  Sum_probs=6.3

Q ss_pred             hhhHHHHHHHHHH
Q 040193            3 KLSFNNIFVFLLI   15 (80)
Q Consensus         3 K~s~~~~~i~~lv   15 (80)
                      |++++.|++++++
T Consensus         2 Kll~~lilli~~~   14 (212)
T PF11912_consen    2 KLLISLILLILLI   14 (212)
T ss_pred             cHHHHHHHHHHHH
Confidence            6655554443333


No 43 
>PF13172 PepSY_TM_1:  PepSY-associated TM helix
Probab=27.76  E-value=87  Score=15.46  Aligned_cols=14  Identities=50%  Similarity=0.878  Sum_probs=7.2

Q ss_pred             HHHHHHHHHHHHHh
Q 040193            8 NIFVFLLILSAALM   21 (80)
Q Consensus         8 ~~~i~~lvls~~~~   21 (80)
                      .++++++.++++.+
T Consensus        17 ~~~ll~~~lTG~~l   30 (34)
T PF13172_consen   17 AIFLLLLALTGALL   30 (34)
T ss_pred             HHHHHHHHHHHHHH
Confidence            44455555555544


No 44 
>TIGR00247 conserved hypothetical protein, YceG family. This uncharacterized protein family, found in three of four microbial genomes, virtually always once per genome, includes YceG from Escherichia coli. This protein is encoded next to PabC, 4-amino-4-deoxychorismate lyase, in E. coli and numerous other proteobacteria, but that proximity is not conserved in other lineages. Numerous members of this family have been misannotated as aminodeoxychorismate lyase, apparently because of promiximty to PabC.
Probab=27.71  E-value=68  Score=23.98  Aligned_cols=16  Identities=25%  Similarity=0.517  Sum_probs=8.5

Q ss_pred             CchhhHHHHHHHHHHH
Q 040193            1 MAKLSFNNIFVFLLIL   16 (80)
Q Consensus         1 MaK~s~~~~~i~~lvl   16 (80)
                      |-|+..+++++++|++
T Consensus         1 ~~~~~~~i~~~~vl~~   16 (342)
T TIGR00247         1 MKKFLIIILLLFVLFF   16 (342)
T ss_pred             ChhHHHHHHHHHHHHH
Confidence            6666555554444444


No 45 
>PRK13664 hypothetical protein; Provisional
Probab=27.65  E-value=71  Score=18.63  Aligned_cols=15  Identities=13%  Similarity=0.456  Sum_probs=6.9

Q ss_pred             HHHHHHHHHHhhhhh
Q 040193           11 VFLLILSAALMAVRR   25 (80)
Q Consensus        11 i~~lvls~~~~~~~~   25 (80)
                      |++|++|+.+-++++
T Consensus        12 ill~lvG~i~N~iK~   26 (62)
T PRK13664         12 VLVFLVGVLLNVIKD   26 (62)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            444444654433444


No 46 
>PF00008 EGF:  EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry;  InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins. The list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied. The functional significance of EGF domains in what appear to be unrelated proteins is not yet clear. However, a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase). The EGF domain includes six cysteine residues which have been shown (in EGF) to be involved in disulphide bonds. The main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet. Subdomains between the conserved cysteines vary in length.; GO: 0005515 protein binding; PDB: 1WHE_A 1CCF_A 1APO_A 1WHF_A 2VJ3_A 1TOZ_A 4D90_B 3CFW_A 1EDM_B 1IXA_A ....
Probab=26.50  E-value=50  Score=16.11  Aligned_cols=18  Identities=44%  Similarity=1.025  Sum_probs=13.4

Q ss_pred             CeeeEEeeCCCCCCcceeEe
Q 040193           58 RGFGECIENGAHTGYDCYCF   77 (80)
Q Consensus        58 ~G~G~C~~~~~~~~~~C~C~   77 (80)
                      || |+|++.. .+.+.|.|.
T Consensus         8 n~-g~C~~~~-~~~y~C~C~   25 (32)
T PF00008_consen    8 NG-GTCIDLP-GGGYTCECP   25 (32)
T ss_dssp             TT-EEEEEES-TSEEEEEEB
T ss_pred             CC-eEEEeCC-CCCEEeECC
Confidence            44 8999875 357889985


No 47 
>PF11395 DUF2873:  Protein of unknown function (DUF2873);  InterPro: IPR021532 This entry is represented by the human SARS coronavirus, Orf7b; it is a family of uncharacterised viral proteins.
Probab=25.68  E-value=1.2e+02  Score=16.23  Aligned_cols=10  Identities=10%  Similarity=0.401  Sum_probs=4.7

Q ss_pred             hhcccccccc
Q 040193           25 RVDAQVKRCE   34 (80)
Q Consensus        25 ~~qg~~~~C~   34 (80)
                      |.|.-++.|+
T Consensus        33 e~qdl~epct   42 (43)
T PF11395_consen   33 EIQDLNEPCT   42 (43)
T ss_pred             hhhhhccccc
Confidence            5664334443


No 48 
>KOG3384 consensus Selenoprotein [General function prediction only]
Probab=25.53  E-value=73  Score=21.73  Aligned_cols=32  Identities=22%  Similarity=0.438  Sum_probs=16.8

Q ss_pred             CchhhHHHHHHHHHHHHHHHhhhhhhccccccccc
Q 040193            1 MAKLSFNNIFVFLLILSAALMAVRRVDAQVKRCEE   35 (80)
Q Consensus         1 MaK~s~~~~~i~~lvls~~~~~~~~~qg~~~~C~~   35 (80)
                      |+|+..+..++.+++.+.+.. .++.+-  +.|.+
T Consensus         1 ~~~m~vl~~ll~~vl~~~~~~-~ee~s~--eeC~~   32 (154)
T KOG3384|consen    1 MAKMVVLSLLLALVLASTISA-KEELST--EECED   32 (154)
T ss_pred             CchHHHHHHHHHHHHHHHHHH-HHHhhH--HHHHH
Confidence            788877666554444342222 344432  45654


No 49 
>PRK09039 hypothetical protein; Validated
Probab=25.19  E-value=73  Score=23.96  Aligned_cols=11  Identities=18%  Similarity=0.567  Sum_probs=5.6

Q ss_pred             HHHHHHHHHHh
Q 040193           11 VFLLILSAALM   21 (80)
Q Consensus        11 i~~lvls~~~~   21 (80)
                      ++|+||++||+
T Consensus        29 ~~~f~l~~f~~   39 (343)
T PRK09039         29 VIMFLLTVFVV   39 (343)
T ss_pred             HHHHHHHHHHH
Confidence            34444555554


No 50 
>PF10731 Anophelin:  Thrombin inhibitor from mosquito;  InterPro: IPR018932  Members of this family are all inhibitors of thrombin, the peptidase that is at the end of the blood coagulation cascade and which creates the clot by cleaving fibrinogen. The interaction between thrombin and fibrinogen involves two different areas of contact - via the thrombin active site and via a second substrate-binding site known as an exosite. The inhibitor acts by blocking the exosite, rather than by interacting with the active site. The inhibitors are from mosquitoes that feed on human blood and which, by inhibiting thrombin, prevent the blood from clotting and keep it flowing. 
Probab=24.77  E-value=72  Score=18.77  Aligned_cols=15  Identities=33%  Similarity=0.443  Sum_probs=8.4

Q ss_pred             Cc-hhhHHHHHHHHHH
Q 040193            1 MA-KLSFNNIFVFLLI   15 (80)
Q Consensus         1 Ma-K~s~~~~~i~~lv   15 (80)
                      || |+..++|+-+.|+
T Consensus         1 MA~Kl~vialLC~aLv   16 (65)
T PF10731_consen    1 MASKLIVIALLCVALV   16 (65)
T ss_pred             CcchhhHHHHHHHHHH
Confidence            66 7666665544443


No 51 
>PHA00645 hypothetical protein
Probab=24.74  E-value=49  Score=21.63  Aligned_cols=28  Identities=18%  Similarity=0.463  Sum_probs=16.0

Q ss_pred             CchhhHHHHHHHHHHHHHHHhhhhhhcc
Q 040193            1 MAKLSFNNIFVFLLILSAALMAVRRVDA   28 (80)
Q Consensus         1 MaK~s~~~~~i~~lvls~~~~~~~~~qg   28 (80)
                      |+-+++.+|.++.-|+.+.+.|+..+..
T Consensus        38 ~Tnipl~v~wviggVi~~~~~~i~~tst   65 (125)
T PHA00645         38 MTNTSIAYFLVFFMVIKLSIYAIHGTST   65 (125)
T ss_pred             CCCCchHHHHHHHHHHHhheeEEcccch
Confidence            4556666666666666544444566543


No 52 
>PRK12750 cpxP periplasmic repressor CpxP; Reviewed
Probab=24.51  E-value=74  Score=21.71  Aligned_cols=21  Identities=29%  Similarity=0.183  Sum_probs=12.8

Q ss_pred             CchhhHHHHHHHHHHHHHHHh
Q 040193            1 MAKLSFNNIFVFLLILSAALM   21 (80)
Q Consensus         1 MaK~s~~~~~i~~lvls~~~~   21 (80)
                      |+|-..++.+.+.|+||+.++
T Consensus         3 ~~kkl~~~~v~~~l~lg~~sa   23 (170)
T PRK12750          3 LAKKLVLAAVVLPLTLGTASA   23 (170)
T ss_pred             hHHHHHHHHHHHHHHHHhhhh
Confidence            565555556667888765443


No 53 
>PF11044 TMEMspv1-c74-12:  Plectrovirus spv1-c74 ORF 12 transmembrane protein;  InterPro: IPR022743  This is a group of proteins expressed by Plectroviruses. The Plectroviruses are single-stranded DNA viruses belonging to the Inoviridae. This entry represents putative transmembrane proteins of unknown function. 
Probab=24.23  E-value=1.1e+02  Score=17.00  Aligned_cols=13  Identities=31%  Similarity=0.539  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHHHH
Q 040193            7 NNIFVFLLILSAA   19 (80)
Q Consensus         7 ~~~~i~~lvls~~   19 (80)
                      ..||-++++|++|
T Consensus         6 t~iFsvvIil~If   18 (49)
T PF11044_consen    6 TTIFSVVIILGIF   18 (49)
T ss_pred             HHHHHHHHHHHHH
Confidence            3445455555553


No 54 
>PF08999 SP_C-Propep:  Surfactant protein C, N terminal propeptide;  InterPro: IPR015091 The N-terminal propeptide of surfactant protein C adopts an alpha-helical structure, with turn and extended regions. Its main function is the stabilisation of metastable surfactant protein C (SP-C), since the latter can irreversibly transform from its native alpha-helical structure to beta-sheet aggregates and form amyloid-like fibrils. The correct intracellular trafficking of proSP-C has also been reported to depend on the propeptide []. ; PDB: 1SPF_A 2YAD_F.
Probab=23.47  E-value=1.1e+02  Score=19.02  Aligned_cols=15  Identities=27%  Similarity=0.392  Sum_probs=4.2

Q ss_pred             HHHHHHhhhhhhccc
Q 040193           15 ILSAALMAVRRVDAQ   29 (80)
Q Consensus        15 vls~~~~~~~~~qg~   29 (80)
                      ++++.+|+..-+|+.
T Consensus        50 ivg~LLMGLhmsqkH   64 (93)
T PF08999_consen   50 IVGALLMGLHMSQKH   64 (93)
T ss_dssp             HHHHHHH--------
T ss_pred             HHHHHHHHhhhhhhh
Confidence            336667766667654


No 55 
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=22.89  E-value=1.2e+02  Score=15.34  Aligned_cols=14  Identities=29%  Similarity=0.812  Sum_probs=7.0

Q ss_pred             HHHHHHHHHHHHHh
Q 040193            8 NIFVFLLILSAALM   21 (80)
Q Consensus         8 ~~~i~~lvls~~~~   21 (80)
                      .+++++..+++.++
T Consensus        16 g~~l~~~~~tG~~~   29 (37)
T PF13706_consen   16 GLLLFVIFLTGAVM   29 (37)
T ss_pred             HHHHHHHHHHhHHH
Confidence            44444555555444


No 56 
>CHL00031 psbT photosystem II protein T
Probab=22.84  E-value=1.3e+02  Score=15.53  Aligned_cols=13  Identities=15%  Similarity=0.291  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHHH
Q 040193            6 FNNIFVFLLILSA   18 (80)
Q Consensus         6 ~~~~~i~~lvls~   18 (80)
                      +.|.|+++.-|++
T Consensus         4 lvYtfll~~tlgi   16 (33)
T CHL00031          4 LVYTFLLVSTLGI   16 (33)
T ss_pred             hHHHHHHHHHHHH
Confidence            4566666665554


No 57 
>PRK11875 psbT photosystem II reaction center protein T; Reviewed
Probab=22.77  E-value=1.2e+02  Score=15.36  Aligned_cols=13  Identities=31%  Similarity=0.562  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHHH
Q 040193            6 FNNIFVFLLILSA   18 (80)
Q Consensus         6 ~~~~~i~~lvls~   18 (80)
                      +.|.|+++..|++
T Consensus         4 l~Ytfll~~tlgi   16 (31)
T PRK11875          4 FAYILILTLALVT   16 (31)
T ss_pred             HHHHHHHHHHHHH
Confidence            4566666655554


No 58 
>PF02468 PsbN:  Photosystem II reaction centre N protein (psbN);  InterPro: IPR003398 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight transmembrane protein PsbN found in PSII. PsbN may have a role in PSII stability, however its actual function unknown. PsbN does not appear to be essential for photoautotrophic growth or normal PSII function.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane
Probab=22.07  E-value=80  Score=17.17  Aligned_cols=15  Identities=27%  Similarity=0.377  Sum_probs=9.3

Q ss_pred             hhHHHHHHHHHHHHH
Q 040193            4 LSFNNIFVFLLILSA   18 (80)
Q Consensus         4 ~s~~~~~i~~lvls~   18 (80)
                      .+.+.|||..+++|+
T Consensus         4 a~~~~i~i~~~lv~~   18 (43)
T PF02468_consen    4 ATVLAIFISCLLVSI   18 (43)
T ss_pred             eeeHHHHHHHHHHHH
Confidence            345666776776664


No 59 
>PHA03066 Hypothetical protein; Provisional
Probab=22.01  E-value=98  Score=20.11  Aligned_cols=18  Identities=22%  Similarity=0.395  Sum_probs=11.5

Q ss_pred             CchhhHHHHHHHHHHHHH
Q 040193            1 MAKLSFNNIFVFLLILSA   18 (80)
Q Consensus         1 MaK~s~~~~~i~~lvls~   18 (80)
                      ||-+..++||++.|++.=
T Consensus         1 ~~~~~~l~fFi~Fl~~~Y   18 (110)
T PHA03066          1 ASSLLYLLFFIIFLCISY   18 (110)
T ss_pred             CchHHHHHHHHHHHHHHH
Confidence            566666777776666543


No 60 
>KOG4455 consensus Uncharacterized conserved protein [Function unknown]
Probab=21.94  E-value=1.2e+02  Score=19.65  Aligned_cols=21  Identities=33%  Similarity=0.365  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHhhhhhhccc
Q 040193            7 NNIFVFLLILSAALMAVRRVDAQ   29 (80)
Q Consensus         7 ~~~~i~~lvls~~~~~~~~~qg~   29 (80)
                      +..|+.++++++.++  -+.|+|
T Consensus        53 i~Y~l~~~i~~il~~--~K~~~~   73 (110)
T KOG4455|consen   53 IFYFLSVLILSILLV--LKAGGQ   73 (110)
T ss_pred             HHHHHHHHHHHHHHH--HHHCCC
Confidence            334555666666666  357765


No 61 
>PF02495 7kD_coat:  7kD viral coat protein;  InterPro: IPR003411 This family consists of a 7 kDa coat protein from Carlavirus and Potexvirus [].
Probab=21.58  E-value=1.6e+02  Score=16.33  Aligned_cols=8  Identities=13%  Similarity=0.131  Sum_probs=6.9

Q ss_pred             cccccccc
Q 040193           31 KRCEEKSN   38 (80)
Q Consensus        31 ~~C~~~i~   38 (80)
                      +.|.-+++
T Consensus        25 ~~C~I~It   32 (59)
T PF02495_consen   25 PSCVIVIT   32 (59)
T ss_pred             CCcEEEEe
Confidence            79998887


No 62 
>PF04068 RLI:  Possible Fer4-like domain in RNase L inhibitor, RLI;  InterPro: IPR007209 This is a possible metal-binding domain in endoribonuclease RNase L inhibitor. It is found at the N-terminal end of RNase L inhibitor proteins, adjacent to the 4Fe-4S binding domain, fer4, IPR001450 from INTERPRO. Also often found adjacent to IPR007177 from INTERPRO in uncharacterised proteins. The RNase L system plays a major role in the anti-viral and anti-proliferative activities of interferons [], and could possibly play a more general role in the regulation of RNA stability in mammalian cells. Inhibitory activity requires concentration-dependent association of RLI with RNase L [].; PDB: 3J16_B 3BK7_A.
Probab=21.15  E-value=22  Score=18.24  Aligned_cols=16  Identities=25%  Similarity=0.586  Sum_probs=8.4

Q ss_pred             cc-ccCChhhHHH-HhHh
Q 040193           37 SN-PNCSLEDCRA-KCIN   52 (80)
Q Consensus        37 i~-~~C~~~~C~~-~C~~   52 (80)
                      |+ +.||+..|.. .|.+
T Consensus         6 ~d~~~CdPkKCt~~kl~r   23 (35)
T PF04068_consen    6 WDFDQCDPKKCTGKKLIR   23 (35)
T ss_dssp             E-CCC--CCCCSS-HHHH
T ss_pred             EEcCCCCccccCHHHHHh
Confidence            44 5688777777 6653


No 63 
>PLN03207 stomagen; Provisional
Probab=20.93  E-value=1.3e+02  Score=19.49  Aligned_cols=10  Identities=40%  Similarity=0.800  Sum_probs=4.6

Q ss_pred             HHHHHHHHHH
Q 040193           11 VFLLILSAAL   20 (80)
Q Consensus        11 i~~lvls~~~   20 (80)
                      ++.|+|+.++
T Consensus        19 l~~llla~~v   28 (113)
T PLN03207         19 LFFLLLGAYV   28 (113)
T ss_pred             HHHHHHHHHH
Confidence            3444445443


No 64 
>PF14865 Macin:  Macin; PDB: 2K35_A 2LN8_A.
Probab=20.75  E-value=1.3e+02  Score=17.39  Aligned_cols=21  Identities=24%  Similarity=0.544  Sum_probs=12.3

Q ss_pred             hhHHHHhHhhccCCCeeeEEeeCC
Q 040193           44 EDCRAKCINKYINKRGFGECIENG   67 (80)
Q Consensus        44 ~~C~~~C~~k~~~~~G~G~C~~~~   67 (80)
                      .+|...|...-   .--|.|+..+
T Consensus        22 ~sC~~~Ckc~G---~~gG~C~~~p   42 (59)
T PF14865_consen   22 KSCNDRCKCLG---HDGGECVLSP   42 (59)
T ss_dssp             -CCHHHHHTTT----SEEEEEE-C
T ss_pred             hHhhHHHHHcC---CCCCceEeCC
Confidence            46777777332   4459999764


No 65 
>PF13980 UPF0370:  Uncharacterised protein family (UPF0370)
Probab=20.27  E-value=1.1e+02  Score=17.93  Aligned_cols=15  Identities=7%  Similarity=0.505  Sum_probs=6.8

Q ss_pred             HHHHHHHHHHhhhhh
Q 040193           11 VFLLILSAALMAVRR   25 (80)
Q Consensus        11 i~~lvls~~~~~~~~   25 (80)
                      |+++++|+++-|+++
T Consensus        11 iLl~lvG~i~n~iK~   25 (63)
T PF13980_consen   11 ILLILVGMIINGIKE   25 (63)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            334444655443444


No 66 
>KOG3950 consensus Gamma/delta sarcoglycan [Cytoskeleton]
Probab=20.25  E-value=1e+02  Score=23.10  Aligned_cols=12  Identities=33%  Similarity=0.495  Sum_probs=7.4

Q ss_pred             HHHHHHHHHHHH
Q 040193            6 FNNIFVFLLILS   17 (80)
Q Consensus         6 ~~~~~i~~lvls   17 (80)
                      ++|+|+|+|.+.
T Consensus        36 cLY~fvLlL~i~   47 (292)
T KOG3950|consen   36 CLYTFVLLLMIL   47 (292)
T ss_pred             HHHHHHHHHHHH
Confidence            567776666554


No 67 
>COG3354 FlaG Putative archaeal flagellar protein G [Cell motility and secretion]
Probab=20.23  E-value=1.4e+02  Score=20.51  Aligned_cols=18  Identities=22%  Similarity=0.287  Sum_probs=12.5

Q ss_pred             hhHHHHHHHHHHHHHHHh
Q 040193            4 LSFNNIFVFLLILSAALM   21 (80)
Q Consensus         4 ~s~~~~~i~~lvls~~~~   21 (80)
                      .|=+.|||..|++++.++
T Consensus         6 ~SeLV~FIaalLiaasva   23 (154)
T COG3354           6 SSELVMFIAALLIAASVA   23 (154)
T ss_pred             hhHHHHHHHHHHHHHHHH
Confidence            455678888888866554


No 68 
>PF15048 OSTbeta:  Organic solute transporter subunit beta protein
Probab=20.22  E-value=1.4e+02  Score=19.79  Aligned_cols=18  Identities=22%  Similarity=0.301  Sum_probs=8.9

Q ss_pred             hhHHHHHHHHHHHHHHHh
Q 040193            4 LSFNNIFVFLLILSAALM   21 (80)
Q Consensus         4 ~s~~~~~i~~lvls~~~~   21 (80)
                      .|.+++-.+++++|.++.
T Consensus        37 ysiL~Ls~vvlvi~~~LL   54 (125)
T PF15048_consen   37 YSILALSFVVLVISFFLL   54 (125)
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            344444445555555544


No 69 
>TIGR03063 srtB_target sortase B cell surface sorting signal. Two different classes of sorting signal, both analogous to the sortase A signal LPXTG, may be recognized by the sortase SrtB. These are given as NXZTN and NPKXZ. Proteins sorted by this class of sortase are less common than the sortase A and LPXTG system. This model describes a number of cell surface protein C-terminal regions from Gram-positive bacteria that appear to be sortase B (SrtB) sorting signals.
Probab=20.12  E-value=1.4e+02  Score=14.88  Aligned_cols=12  Identities=17%  Similarity=0.357  Sum_probs=6.0

Q ss_pred             HHHHHHHHHHHH
Q 040193            7 NNIFVFLLILSA   18 (80)
Q Consensus         7 ~~~~i~~lvls~   18 (80)
                      +++++++++.|+
T Consensus        10 i~ly~~l~~~s~   21 (29)
T TIGR03063        10 IGLYAVLFLGSG   21 (29)
T ss_pred             HHHHHHHHHHHH
Confidence            355555555443


No 70 
>KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures]
Probab=20.11  E-value=33  Score=27.69  Aligned_cols=27  Identities=37%  Similarity=0.935  Sum_probs=16.6

Q ss_pred             cccccccc-ccCChhhHHHHhHhhccCCCeeeEEe
Q 040193           31 KRCEEKSN-PNCSLEDCRAKCINKYINKRGFGECI   64 (80)
Q Consensus        31 ~~C~~~i~-~~C~~~~C~~~C~~k~~~~~G~G~C~   64 (80)
                      =.|++-+. +.|+...|-+.|.       |.|.|+
T Consensus       298 CiC~~g~~G~dCs~~~cpadC~-------g~G~Ci  325 (525)
T KOG1225|consen  298 CICNPGYSGKDCSIRRCPADCS-------GHGKCI  325 (525)
T ss_pred             eecCCCccccccccccCCccCC-------CCCccc
Confidence            35666666 6677766666664       446666


Done!