BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 040215
(123 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3I9F|A Chain A, Crystal Structure Of A Putative Type 11 Methyltransferase
From Sulfolobus Solfataricus
pdb|3I9F|B Chain B, Crystal Structure Of A Putative Type 11 Methyltransferase
From Sulfolobus Solfataricus
Length = 170
Score = 27.3 bits (59), Expect = 2.3, Method: Compositional matrix adjust.
Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%)
Query: 2 EKSDTVVTWEDQQNINK----FSKLNNRFHELEDEIKFAKETNDNLEDAGNELIL 52
EK D+V+T D + I F N FH+++D+ E L+D G +I+
Sbjct: 57 EKFDSVITLSDPKEIPDNSVDFILFANSFHDMDDKQHVISEVKRILKDDGRVIII 111
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.312 0.132 0.363
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,731,865
Number of Sequences: 62578
Number of extensions: 84968
Number of successful extensions: 204
Number of sequences better than 100.0: 24
Number of HSP's better than 100.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 182
Number of HSP's gapped (non-prelim): 25
length of query: 123
length of database: 14,973,337
effective HSP length: 85
effective length of query: 38
effective length of database: 9,654,207
effective search space: 366859866
effective search space used: 366859866
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)