BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 040215
         (123 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3I9F|A Chain A, Crystal Structure Of A Putative Type 11 Methyltransferase
           From Sulfolobus Solfataricus
 pdb|3I9F|B Chain B, Crystal Structure Of A Putative Type 11 Methyltransferase
           From Sulfolobus Solfataricus
          Length = 170

 Score = 27.3 bits (59), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 2   EKSDTVVTWEDQQNINK----FSKLNNRFHELEDEIKFAKETNDNLEDAGNELIL 52
           EK D+V+T  D + I      F    N FH+++D+     E    L+D G  +I+
Sbjct: 57  EKFDSVITLSDPKEIPDNSVDFILFANSFHDMDDKQHVISEVKRILKDDGRVIII 111


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.312    0.132    0.363 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,731,865
Number of Sequences: 62578
Number of extensions: 84968
Number of successful extensions: 204
Number of sequences better than 100.0: 24
Number of HSP's better than 100.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 182
Number of HSP's gapped (non-prelim): 25
length of query: 123
length of database: 14,973,337
effective HSP length: 85
effective length of query: 38
effective length of database: 9,654,207
effective search space: 366859866
effective search space used: 366859866
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)