BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 040233
(366 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3BTP|A Chain A, Crystal Structure Of Agrobacterium Tumefaciens Vire2 In
Complex With Its Chaperone Vire1: A Novel Fold And
Implications For Dna Binding
Length = 556
Score = 29.3 bits (64), Expect = 3.9, Method: Compositional matrix adjust.
Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%)
Query: 160 FKAAGDPFTEEFFQIFQSVYKQQISMLEKLQLR-KNKLDKKLKYIHSWRKVSSIIFAATF 218
++ AGD + + F+ F+ K + +++L+ K+ + KY+ SW + S+ I A F
Sbjct: 276 YRFAGDAYANKRFEEFERAIKTKYGSDTEIKLKSKSGIMHDSKYLESWERGSADIRFAEF 335
Query: 219 A 219
A
Sbjct: 336 A 336
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.133 0.369
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,771,786
Number of Sequences: 62578
Number of extensions: 309233
Number of successful extensions: 1052
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1052
Number of HSP's gapped (non-prelim): 1
length of query: 366
length of database: 14,973,337
effective HSP length: 100
effective length of query: 266
effective length of database: 8,715,537
effective search space: 2318332842
effective search space used: 2318332842
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)