Citrus Sinensis ID: 040295


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
ITYLSFRSHDIVSISLLIAIDEDRLSFVRVLIFGRQEMDSTDRASLEKRPGILIIGSSNVGKRTILSRLLSVNFEDASDSSSELLVNGWTINTKYYTADVSLWMAHLHEEFSIRSLPISDQLTALVMVFNLNDLSTLDALKHWVPSIDLQKFEILLCIGNKVDLLPGHPVHAEYRRRLLKREESSADPDFCQSGISETEGSSLLGDEEPSWEIRRSCLEWCTEHRIEYIEACASNVDFDKCLSIDGDSQGVERLYGALSAHMWPGMVLKSGDKITEPSLPVKEVMMKKD
ccEEcccccccEEEEEEEEEcccccHHHHHHHcccccccccccccccccccEEEEccccccHHHHHHHHHcccccccccccccEEEEEEEEEEccEEEEEEEEEcccccccccccccccccccEEEEEEEcccHHHHHHHHHHHHHHccccccEEEEEECcccccccccccHHHHHHHHHHHcccccccccccccHHHccccccccccccHHHHHHHHHHHcccccHHHEccccccccccccccccccHHHHHHHHHHHHccccccEEccccccccccccccccccccc
*TYLSFRSHDIVSISLLIAIDEDRLSFVRVLIFGRQ*************PGILIIGSSNVGKRTILSRLLSVNFEDASDSSSELLVNGWTINTKYYTADVSLWMAHLHEEFSIRSLPISDQLTALVMVFNLNDLSTLDALKHWVPSIDLQKFEILLCIGNKVDLLPGHPVHAEYRRRLLKREESSADPDFCQSGISETEGSSL*******WEIRRSCLEWCTEHRIEYIEACASNVDFDKCLSIDGDSQGVERLYGALSAHMWPGMVLK********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ITYLSFRSHDIVSISLLIAIDEDRLSFVRVLIFGRQEMDSTDRASLEKRPGILIIGSSNVGKRTILSRLLSVNFEDASDSSSELLVNGWTINTKYYTADVSLWMAHLHEEFSIRSLPISDQLTALVMVFNLNDLSTLDALKHWVPSIDLQKFEILLCIGNKVDLLPGHPVHAEYRRRLLKREESSADPDFCQSGISETEGSSLLGDEEPSWEIRRSCLEWCTEHRIEYIEACASNVDFDKCLSIDGDSQGVERLYGALSAHMWPGMVLKSGDKITEPSLPVKEVMMKKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G16, chain A
Confidence level:very confident
Coverage over the Query: 50-171,214-236,249-265
View the alignment between query and template
View the model in PyMOL
Template: 2FV8, chain A
Confidence level:confident
Coverage over the Query: 43-181,205-236,249-265
View the alignment between query and template
View the model in PyMOL
Template: 1AZS, chain C
Confidence level:confident
Coverage over the Query: 80-236,249-264
View the alignment between query and template
View the model in PyMOL
Template: 3UC9, chain A
Confidence level:probable
Coverage over the Query: 49-178,215-270
View the alignment between query and template
View the model in PyMOL