Query 040325
Match_columns 152
No_of_seqs 158 out of 844
Neff 6.5
Searched_HMMs 46136
Date Fri Mar 29 07:21:02 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/040325.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/040325hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 cd06899 lectin_legume_LecRK_Ar 99.9 4.2E-22 9.2E-27 160.4 9.6 77 7-83 159-235 (236)
2 PF00139 Lectin_legB: Legume l 99.8 9.7E-21 2.1E-25 152.1 9.1 77 4-81 160-236 (236)
3 cd01951 lectin_L-type legume l 99.7 6.8E-17 1.5E-21 128.2 9.5 71 10-82 153-223 (223)
4 cd07308 lectin_leg-like legume 98.3 3.5E-06 7.5E-11 66.8 8.8 65 11-81 152-216 (218)
5 cd06902 lectin_ERGIC-53_ERGL E 98.0 4.4E-05 9.5E-10 61.5 9.0 68 11-82 155-223 (225)
6 PF03388 Lectin_leg-like: Legu 96.7 0.012 2.5E-07 47.4 8.5 65 10-79 158-224 (229)
7 cd06903 lectin_EMP46_EMP47 EMP 96.6 0.015 3.3E-07 46.5 8.6 63 9-81 149-212 (215)
8 PF15065 NCU-G1: Lysosomal tra 96.4 0.0047 1E-07 52.9 4.8 31 56-86 279-309 (350)
9 KOG3839 Lectin VIP36, involved 96.2 0.016 3.5E-07 49.3 6.7 59 15-80 213-272 (351)
10 PF08693 SKG6: Transmembrane a 96.2 0.0092 2E-07 35.7 3.7 30 104-136 10-39 (40)
11 cd06901 lectin_VIP36_VIPL VIP3 96.1 0.039 8.5E-07 45.1 8.5 67 10-82 156-222 (248)
12 KOG3838 Mannose lectin ERGIC-5 95.9 0.038 8.3E-07 48.2 7.6 66 13-83 189-256 (497)
13 PF06697 DUF1191: Protein of u 95.2 0.11 2.4E-06 43.3 7.8 11 108-118 216-226 (278)
14 PF04478 Mid2: Mid2 like cell 94.0 0.091 2E-06 40.2 4.2 13 110-122 55-67 (154)
15 PTZ00382 Variant-specific surf 92.7 0.13 2.8E-06 36.3 3.1 30 104-133 64-93 (96)
16 PF15102 TMEM154: TMEM154 prot 92.7 0.26 5.6E-06 37.4 4.9 17 106-122 58-74 (146)
17 PHA03265 envelope glycoprotein 88.2 0.21 4.5E-06 43.0 0.9 29 104-137 349-377 (402)
18 PF01299 Lamp: Lysosome-associ 86.7 0.49 1.1E-05 39.5 2.3 31 107-138 271-301 (306)
19 PF14610 DUF4448: Protein of u 86.3 0.58 1.2E-05 36.4 2.4 28 106-137 159-186 (189)
20 cd06900 lectin_VcfQ VcfQ bacte 85.4 4.6 9.9E-05 33.3 7.2 28 52-79 225-252 (255)
21 PF05454 DAG1: Dystroglycan (D 85.3 0.26 5.7E-06 41.3 0.0 17 124-141 163-179 (290)
22 PF06365 CD34_antigen: CD34/Po 85.1 0.96 2.1E-05 36.1 3.1 28 107-136 101-129 (202)
23 PF05545 FixQ: Cbb3-type cytoc 82.2 0.62 1.3E-05 28.5 0.8 13 124-137 24-36 (49)
24 PF03302 VSP: Giardia variant- 80.5 1.4 3.1E-05 38.3 2.7 30 104-133 365-394 (397)
25 PF01102 Glycophorin_A: Glycop 77.9 0.39 8.6E-06 35.4 -1.3 8 130-137 87-94 (122)
26 PF14283 DUF4366: Domain of un 74.7 3.3 7.2E-05 33.4 3.1 25 6-32 78-102 (218)
27 PF02480 Herpes_gE: Alphaherpe 73.9 1 2.3E-05 39.8 0.0 8 74-81 293-300 (439)
28 PF12877 DUF3827: Domain of un 73.2 3 6.5E-05 38.7 2.7 31 102-134 266-296 (684)
29 PF14575 EphA2_TM: Ephrin type 72.3 0.74 1.6E-05 30.9 -1.0 6 130-135 22-27 (75)
30 PF12191 stn_TNFRSF12A: Tumour 72.2 1.5 3.3E-05 32.5 0.5 31 105-138 77-107 (129)
31 PF06024 DUF912: Nucleopolyhed 71.4 7.7 0.00017 27.3 4.0 8 130-137 85-92 (101)
32 PHA03283 envelope glycoprotein 67.2 11 0.00024 34.3 4.9 7 75-81 340-346 (542)
33 PF11770 GAPT: GRB2-binding ad 66.8 2.7 5.9E-05 32.1 0.9 19 115-135 18-36 (158)
34 PF15069 FAM163: FAM163 family 66.3 7.3 0.00016 29.5 3.1 23 105-128 5-27 (143)
35 PF14851 FAM176: FAM176 family 65.0 3.9 8.4E-05 31.3 1.4 16 107-122 26-41 (153)
36 PF13908 Shisa: Wnt and FGF in 62.2 8.4 0.00018 29.5 2.9 15 104-118 77-91 (179)
37 PF07213 DAP10: DAP10 membrane 58.9 3.8 8.2E-05 28.0 0.4 18 105-122 33-50 (79)
38 TIGR01478 STEVOR variant surfa 56.4 3.1 6.6E-05 35.0 -0.5 8 132-139 283-290 (295)
39 PTZ00370 STEVOR; Provisional 55.1 3.3 7.1E-05 34.8 -0.5 7 132-138 279-285 (296)
40 PF02009 Rifin_STEVOR: Rifin/s 54.6 2 4.3E-05 36.2 -1.9 7 130-136 277-283 (299)
41 PF14283 DUF4366: Domain of un 52.5 26 0.00056 28.2 4.3 6 62-67 78-83 (218)
42 PF05337 CSF-1: Macrophage col 49.1 5.7 0.00012 33.3 0.0 17 106-122 225-241 (285)
43 PF03229 Alpha_GJ: Alphavirus 48.9 3.9 8.5E-05 30.0 -0.8 23 105-128 82-104 (126)
44 PF04689 S1FA: DNA binding pro 45.0 10 0.00022 25.0 0.7 30 104-134 11-40 (69)
45 cd01324 cbb3_Oxidase_CcoQ Cyto 44.6 12 0.00025 23.0 0.9 14 124-138 25-38 (48)
46 PLN03150 hypothetical protein; 43.8 25 0.00054 32.2 3.3 29 106-136 544-572 (623)
47 TIGR01433 CyoA cytochrome o ub 42.8 36 0.00078 27.4 3.8 14 124-138 48-61 (226)
48 COG4736 CcoQ Cbb3-type cytochr 42.1 13 0.00028 24.1 0.8 12 124-136 24-35 (60)
49 PF08114 PMP1_2: ATPase proteo 41.1 2 4.3E-05 25.8 -2.8 14 124-138 23-36 (43)
50 TIGR01495 ETRAMP Plasmodium ri 38.6 21 0.00046 24.6 1.6 6 105-110 50-55 (85)
51 PF11353 DUF3153: Protein of u 38.4 83 0.0018 24.7 5.2 28 40-67 115-143 (209)
52 PF15099 PIRT: Phosphoinositid 37.4 11 0.00024 28.0 0.0 8 61-68 36-43 (129)
53 TIGR03370 PEPCTERM_Roseo varia 37.2 5.6 0.00012 21.6 -1.2 8 115-122 7-14 (26)
54 PHA02104 hypothetical protein 36.1 23 0.0005 23.9 1.4 17 7-23 54-70 (89)
55 cd08389 C2A_Synaptotagmin-14_1 35.8 60 0.0013 23.0 3.7 21 13-33 4-24 (124)
56 PF06809 NPDC1: Neural prolife 35.4 92 0.002 26.8 5.1 7 58-64 144-150 (341)
57 PHA03264 envelope glycoprotein 35.1 84 0.0018 27.7 4.9 18 105-122 360-377 (416)
58 PF05393 Hum_adeno_E3A: Human 34.9 12 0.00027 26.1 -0.1 6 130-135 53-58 (94)
59 PF12248 Methyltransf_FA: Farn 34.4 1.6E+02 0.0034 20.3 6.7 46 8-63 49-94 (102)
60 cd04029 C2A_SLP-4_5 C2 domain 33.8 67 0.0015 22.8 3.7 23 10-33 1-23 (125)
61 PF02480 Herpes_gE: Alphaherpe 33.2 14 0.00031 32.7 0.0 6 114-119 360-365 (439)
62 PF13619 KTSC: KTSC domain 32.4 61 0.0013 20.3 2.9 19 16-34 7-25 (60)
63 PF04478 Mid2: Mid2 like cell 32.4 27 0.00058 26.8 1.4 7 107-113 56-62 (154)
64 PF06422 PDR_CDR: CDR ABC tran 31.0 37 0.0008 23.8 1.8 14 109-122 52-65 (103)
65 PF02404 SCF: Stem cell factor 31.0 16 0.00035 30.4 0.0 8 130-137 235-242 (273)
66 PF15048 OSTbeta: Organic solu 30.2 31 0.00067 25.6 1.4 6 78-83 25-30 (125)
67 PF05568 ASFV_J13L: African sw 29.9 19 0.00042 27.6 0.2 7 130-136 52-58 (189)
68 PF11857 DUF3377: Domain of un 27.5 69 0.0015 21.6 2.5 12 111-122 34-45 (74)
69 PF11225 DUF3024: Protein of u 27.0 54 0.0012 20.5 1.9 21 15-35 6-26 (57)
70 PTZ00208 65 kDa invariant surf 26.8 56 0.0012 29.0 2.5 27 107-136 388-414 (436)
71 PF08374 Protocadherin: Protoc 26.8 33 0.00072 27.8 1.1 12 105-116 37-48 (221)
72 PF02468 PsbN: Photosystem II 26.1 90 0.0019 18.9 2.6 8 143-150 35-42 (43)
73 PRK05886 yajC preprotein trans 25.9 17 0.00036 26.3 -0.7 11 124-135 15-25 (109)
74 PRK08455 fliL flagellar basal 24.9 67 0.0015 25.0 2.5 8 124-132 35-42 (182)
75 PF15102 TMEM154: TMEM154 prot 24.7 84 0.0018 23.9 2.9 6 117-122 66-71 (146)
76 TIGR00739 yajC preprotein tran 24.6 27 0.00059 23.8 0.2 9 125-134 15-23 (84)
77 PF08869 XisI: XisI protein; 24.5 47 0.001 24.0 1.5 19 6-27 61-79 (111)
78 cd08388 C2A_Synaptotagmin-4-11 24.1 1.5E+02 0.0032 21.1 4.0 22 12-33 3-24 (128)
79 TIGR03503 conserved hypothetic 24.0 59 0.0013 28.4 2.2 14 71-84 278-291 (374)
80 KOG3637 Vitronectin receptor, 24.0 68 0.0015 31.6 2.8 17 106-122 979-995 (1030)
81 cd08390 C2A_Synaptotagmin-15-1 24.0 1.3E+02 0.0028 20.6 3.7 21 13-33 2-22 (123)
82 cd00276 C2B_Synaptotagmin C2 d 23.5 1.3E+02 0.0028 20.8 3.6 20 14-33 3-22 (134)
83 KOG3488 Dolichol phosphate-man 23.2 35 0.00075 23.0 0.5 20 107-126 48-67 (81)
84 PF09307 MHC2-interact: CLIP, 23.1 27 0.0006 25.4 0.0 29 104-134 30-58 (114)
85 KOG2952 Cell cycle control pro 23.1 67 0.0015 27.8 2.3 30 107-138 311-341 (351)
86 PRK13183 psbN photosystem II r 22.8 1.4E+02 0.0031 18.3 3.1 9 142-150 37-45 (46)
87 smart00736 CADG Dystroglycan-t 21.4 82 0.0018 21.3 2.1 13 14-26 44-56 (97)
88 PF06129 Chordopox_G3: Chordop 21.3 1.1E+02 0.0024 22.1 2.8 18 14-31 66-83 (109)
89 cd08521 C2A_SLP C2 domain firs 21.0 1.7E+02 0.0036 20.0 3.8 21 14-34 3-23 (123)
90 PF15176 LRR19-TM: Leucine-ric 20.4 82 0.0018 22.5 1.9 9 107-115 19-27 (102)
91 KOG4818 Lysosomal-associated m 20.3 96 0.0021 27.0 2.7 12 124-136 344-355 (362)
92 cd08680 C2_Kibra C2 domain fou 20.2 1.6E+02 0.0035 21.0 3.6 22 13-34 2-23 (124)
No 1
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor. This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin
Probab=99.87 E-value=4.2e-22 Score=160.38 Aligned_cols=77 Identities=40% Similarity=0.596 Sum_probs=72.6
Q ss_pred ccCCCceEEEEEEeeCCCCeEEEEEEcCCCCCcccceeEEeecCCCCCCCceEEEEEeecCCcceeEEEEeeeeeeC
Q 040325 7 DVKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNSS 83 (152)
Q Consensus 7 ~l~sG~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~Ls~~vdLs~~L~e~v~VGFSasTG~~~~~h~ilsWsF~~~ 83 (152)
.+.+|+.++|||+||+.+++|+|+|.+....+|..|+|+..+||+.+|+++||||||||||...|.|+|++|+|+++
T Consensus 159 ~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i~sWsF~s~ 235 (236)
T cd06899 159 KLKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSSN 235 (236)
T ss_pred cccCCCeEEEEEEEcCCCCEEEEEEEeCCCCCCcCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEEEEEEEEEcC
Confidence 36899999999999999999999999776568999999999999999999999999999999999999999999976
No 2
>PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported. Leguminous plant lectins resemble each other in their physicochemical properties although they differ in their carbohydrate specificities. They consist of two or four subunits with relative molecular mass of 30 kDa and each subunit has one carbohydrate-binding site. The interaction with sugars requires tightly bound calcium and manganese ions. The structural similarities of these lectins are reported by the primary structural analyses and X-ray crystallographic studies. X-ray studies have shown that the folding of the polypeptide chains in the region of the carbohydrate-binding sites is also similar, despite differences in the primary sequences. The carbohydrate-binding sites of these lectins consist of two conserved amino acids on beta pleated sheets. One of these loops contains transition metals, calcium and manganese, which keep the amino acid residues of the sugar-binding site at the required positions. Amino acid sequences of this loop play an important role in the carbohydrate-binding specificities of these lectins. These lectins bind either glucose/mannose or galactose. The exact function of legume lectins is not known but they may be involved in the attachment of nitrogen-fixing bacteria to legumes and in the protection against pathogens. Some legume lectins are proteolytically processed to produce two chains, beta (which corresponds to the N-terminal) and alpha (C-terminal) (IPR000985 from INTERPRO). The lectin concanavalin A (conA) from jack bean is exceptional in that the two chains are transposed and ligated (by formation of a new peptide bond). The N terminus of mature conA thus corresponds to that of the alpha chain and the C terminus to the beta chain.; GO: 0005488 binding; PDB: 1VLN_B 2GDF_C 2JE9_C 2JEC_C 1DGL_B 2P37_B 2CWM_A 2P34_D 2OW4_A 3IPV_B ....
Probab=99.84 E-value=9.7e-21 Score=152.08 Aligned_cols=77 Identities=34% Similarity=0.545 Sum_probs=70.3
Q ss_pred eccccCCCceEEEEEEeeCCCCeEEEEEEcCCCCCcccceeEEeecCCCCCCCceEEEEEeecCCcceeEEEEeeeee
Q 040325 4 LRSDVKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFN 81 (152)
Q Consensus 4 ~~~~l~sG~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~Ls~~vdLs~~L~e~v~VGFSasTG~~~~~h~ilsWsF~ 81 (152)
.+.++.+|+.++|||+||+.+++|+|++.... .+|..|+|+..+||+.+|+++||||||||||...|.|.|++|+|+
T Consensus 160 ~~~~l~~g~~~~v~I~Yd~~~~~L~V~l~~~~-~~~~~~~l~~~vdL~~~l~~~v~vGFsasTG~~~~~h~I~sW~F~ 236 (236)
T PF00139_consen 160 PSFSLSDGKWHTVWIDYDASTKRLSVYLDDNS-SKPSSPVLSVNVDLSAVLPEQVYVGFSASTGGSYQTHDILSWSFS 236 (236)
T ss_dssp EEHHHGTTSEEEEEEEEETTTTEEEEEEEETT-TTSEEEEEEEE--HHHHSCSEEEEEEEEEESSSSEEEEEEEEEEE
T ss_pred ccccccCCcEEEEEEEEcCCccEEEEEEeccc-CCCcceeEEEEEchHHhcCCCcEEEEEeecCCCcceEEEEEEEeC
Confidence 45678999999999999999999999999664 489999999999999999999999999999999999999999996
No 3
>cd01951 lectin_L-type legume lectins. The L-type (legume-type) lectins are a highly diverse family of carbohydrate binding proteins that generally display no enzymatic activity toward the sugars they bind. This family includes arcelin, concanavalinA, the lectin-like receptor kinases, the ERGIC-53/VIP36/EMP46 type1 transmembrane proteins, and an alpha-amylase inhibitor. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely.
Probab=99.70 E-value=6.8e-17 Score=128.23 Aligned_cols=71 Identities=28% Similarity=0.448 Sum_probs=65.7
Q ss_pred CCceEEEEEEeeCCCCeEEEEEEcCCCCCcccceeEEeecCCCCCCCceEEEEEeecCCcceeEEEEeeeeee
Q 040325 10 SGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNS 82 (152)
Q Consensus 10 sG~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~Ls~~vdLs~~L~e~v~VGFSasTG~~~~~h~ilsWsF~~ 82 (152)
+|+.++|||+||+.+++|+|++.+... |..|.++.++||+..++++||||||||||...+.|+|++|+|++
T Consensus 153 ~g~~~~v~I~Y~~~~~~L~v~l~~~~~--~~~~~l~~~~~l~~~~~~~~yvGFTAsTG~~~~~h~V~~wsf~~ 223 (223)
T cd01951 153 LGNEHTVRITYDPTTNTLTVYLDNGST--LTSLDITIPVDLIQLGPTKAYFGFTASTGGLTNLHDILNWSFTS 223 (223)
T ss_pred CCCEEEEEEEEeCCCCEEEEEECCCCc--cccccEEEeeeecccCCCcEEEEEEcccCCCcceeEEEEEEecC
Confidence 499999999999999999999986543 67789999999999999999999999999999999999999963
No 4
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47. The legume-like (leg-like) lectins are eukaryotic intracellular sugar transport proteins with a carbohydrate recognition domain similar to that of the legume lectins. This domain binds high-mannose-type oligosaccharides for transport from the endoplasmic reticulum to the Golgi complex. These leg-like lectins include ERGIC-53, ERGL, VIP36, VIPL, EMP46, EMP47, and the UIP5 (ULP1-interacting protein 5) precursor protein. Leg-like lectins have different intracellular distributions and dynamics in the endoplasmic reticulum-Golgi system of the secretory pathway and interact with N-glycans of glycoproteins in a calcium-dependent manner, suggesting a role in glycoprotein sorting and trafficking. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "ba
Probab=98.33 E-value=3.5e-06 Score=66.79 Aligned_cols=65 Identities=25% Similarity=0.119 Sum_probs=49.9
Q ss_pred CceEEEEEEeeCCCCeEEEEEEcCCCCCcccceeEEeecCCCCCCCceEEEEEeecCCcceeEEEEeeeee
Q 040325 11 GRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFN 81 (152)
Q Consensus 11 G~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~Ls~~vdLs~~L~e~v~VGFSasTG~~~~~h~ilsWsF~ 81 (152)
+++++++|.|+ .+.|.|.+.... +....+...++. ..+|+..|+||||+||...+.|.|++|.+.
T Consensus 152 ~~~~~~~I~y~--~~~l~v~i~~~~---~~~~~~c~~~~~-~~l~~~~y~G~sA~tg~~~d~~dIls~~~~ 216 (218)
T cd07308 152 NAPTTLRISYL--NNTLKVDITYSE---GNNWKECFTVED-VILPSQGYFGFSAQTGDLSDNHDILSVHTY 216 (218)
T ss_pred CCCeEEEEEEE--CCEEEEEEeCCC---CCCccEEEEcCC-cccCCCCEEEEEeccCCCcCcEEEEEEEee
Confidence 68999999999 688999997432 122233444332 257889999999999999999999999874
No 5
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain. ERGIC-53 and ERGL, N-terminal carbohydrate recognition domain. ERGIC-53 and ERGL are eukaryotic mannose-binding type 1 transmembrane proteins of the early secretory pathway that transport newly synthesized glycoproteins from the endoplasmic reticulum (ER) to the ER-Golgi intermediate compartment (ERGIC). ERGIC-53 and ERGL have an N-terminal lectin-like carbohydrate recognition domain (represented by this alignment model) as well as a C-terminal transmembrane domain. ERGIC-53 functions as a 'cargo receptor' to facilitate the export of glycoproteins with different characteristics from the ER, while the ERGIC-53-like protein (ERGL) which may act as a regulator of ERGIC-53. In mammals, ERGIC-53 forms a complex with MCFD2 (multi-coagulation factor deficiency 2) which then recruits blood coagulation factors V and VIII. Mutations in either MCFD2 or ERGIC-53 cause a mild form of inherite
Probab=98.00 E-value=4.4e-05 Score=61.49 Aligned_cols=68 Identities=22% Similarity=0.129 Sum_probs=48.6
Q ss_pred CceEEEEEEeeCCCCeEEEEEEcCCCCCcccceeEEeecCCC-CCCCceEEEEEeecCCcceeEEEEeeeeee
Q 040325 11 GRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQ-HLPEFVTFGFSMATGVDFAIFSIYSWEFNS 82 (152)
Q Consensus 11 G~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~Ls~~vdLs~-~L~e~v~VGFSasTG~~~~~h~ilsWsF~~ 82 (152)
..+.++.|.|.. ..|.|.+.... ++.......-.++.. .||+..|+||||+||...+.|.|++|+|.+
T Consensus 155 ~~p~~~rI~Y~~--~~l~V~~d~~~--~~~~~~~~~Cf~~~~v~LP~~~yfGiSA~Tg~l~d~hDIls~~~~s 223 (225)
T cd06902 155 PYPVRAKITYYQ--NVLTVSINNGF--TPNKDDYELCTRVENMVLPPNGYFGVSAATGGLADDHDVLSFLTFS 223 (225)
T ss_pred CCCeEEEEEEEC--CeEEEEEeCCc--CCCCCcccEEEecCCeeCCCCCEEEEEecCCCCCCcEeEEEEEEec
Confidence 467889999998 46888886322 122111222233344 578889999999999999999999999863
No 6
>PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates. This family includes the VIP36 and ERGIC-53 lectins. These two proteins were the first members of the family of animal lectins similar to the leguminous plant lectins []. The alignment for this family is towards the N terminus, where the similarity of VIP36 and ERGIC-53 is greatest. Although they have been identified as a family of animal lectins, this alignment also includes yeast sequences[]. ERGIC-53 is a 53kDa protein, localised to the intermediate region between the endoplasmic reticulum and the Golgi apparatus (ER-Golgi-Intermediate Compartment, ERGIC). It was identified as a calcium-dependent, mannose-specific lectin []. Its dysfunction has been associated with combined factors V and VIII deficiency, suggesting an important and substrate-specific role for ERGIC-53 in the glycoprotein-secreting pathway [,]. The L-type lectin-like domain has an overall globular shape composed of a beta-sandwich of two major twisted antiparallel beta-sheets. The beta-sandwich comprises a major concave beta-sheet and a minor convex beta-sheet, in a variation of the jelly roll fold [, , , ]. ; GO: 0016020 membrane; PDB: 3A4U_A 3LCP_B 2A6Z_A 2A71_C 2A70_B 2A6Y_A 2A6X_A 2A6W_B 2A6V_B 2E6V_B ....
Probab=96.72 E-value=0.012 Score=47.39 Aligned_cols=65 Identities=28% Similarity=0.237 Sum_probs=44.0
Q ss_pred CCceEEEEEEeeCCCCeEEEEEEcC--CCCCcccceeEEeecCCCCCCCceEEEEEeecCCcceeEEEEeee
Q 040325 10 SGRRNEAWISYNSSTHNLSVAFSGL--RNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWE 79 (152)
Q Consensus 10 sG~~~~awI~Yd~~~~~L~V~l~~~--~~~~p~~p~Ls~~vdLs~~L~e~v~VGFSasTG~~~~~h~ilsWs 79 (152)
.+.+.++.|.|... .+.|.+... .....-..++... .-.||+.-|+||||+||...+.|.|++-.
T Consensus 158 ~~~p~~~ri~Y~~~--~l~v~id~~~~~~~~~~~~Cf~~~---~v~LP~~~yfGvSA~Tg~~~d~hdi~s~~ 224 (229)
T PF03388_consen 158 SDVPTRIRISYSKN--TLTVSIDSNYLKNQDDWELCFTTD---GVDLPEGYYFGVSAATGELSDNHDILSVK 224 (229)
T ss_dssp ESSEEEEEEEEETT--EEEEEEETSCCSECCTTEEEEEES---TEEGGSSBEEEEEEEESSSGGEEEEEEEE
T ss_pred CCCCEEEEEEEECC--eEEEEEecccccCCcCCcEEEEcC---CeecCCCCEEEEEecCCCCCCcEEEEEEE
Confidence 45678899999984 577777622 1111222333322 12468889999999999999999999754
No 7
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain. EMP46 and EMP47, N-terminal carbohydrate recognition domain. EMP46 and EMP47 are fungal type-I transmembrane proteins that cycle between the endoplasmic reticulum and the golgi apparatus and are thought to function as cargo receptors that transport newly synthesized glycoproteins. EMP47 is a receptor for EMP46 responsible for the selective transport of EMP46 by forming hetero-oligomerization between the two proteins. EMP46 and EMP47 have an N-terminal lectin-like carbohydrate recognition domain (represented by this alignment model) as well as a C-terminal transmembrane domain. EMP46 and EMP47 are 45% sequence-identical to one another and have sequence homology to a class of intracellular lectins defined by ERGIC-53 and VIP36. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat s
Probab=96.62 E-value=0.015 Score=46.54 Aligned_cols=63 Identities=21% Similarity=0.278 Sum_probs=44.1
Q ss_pred CCCceEEEEEEeeCCCCeEEEEEEcCCCCCcccceeEEeecCCCCCC-CceEEEEEeecCCcceeEEEEeeeee
Q 040325 9 KSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLP-EFVTFGFSMATGVDFAIFSIYSWEFN 81 (152)
Q Consensus 9 ~sG~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~Ls~~vdLs~~L~-e~v~VGFSasTG~~~~~h~ilsWsF~ 81 (152)
.++.+.++.|.|....+.|.|.+.. +.++. ++ .-.|| .--|+||||+||...+.|.|++-.+.
T Consensus 149 n~~~p~~iri~Y~~~~~~l~v~vd~-------~~Cf~--~~-~v~lP~~~y~fGiSAaTg~~~d~hdIl~~~~~ 212 (215)
T cd06903 149 DSGVPSTIRLSYDALNSLFKVQVDN-------RLCFQ--TD-KVQLPQGGYRFGITAANADNPESFEILKLKVW 212 (215)
T ss_pred CCCCCEEEEEEEECCCCEEEEEECC-------CEEEe--cC-CeecCCCCCEEEEEEcCCCCCCcEEEEEEEEe
Confidence 4566788899998877788887742 11222 11 11356 55679999999999999999986653
No 8
>PF15065 NCU-G1: Lysosomal transcription factor, NCU-G1
Probab=96.43 E-value=0.0047 Score=52.95 Aligned_cols=31 Identities=13% Similarity=0.150 Sum_probs=26.1
Q ss_pred CceEEEEEeecCCcceeEEEEeeeeeeCCCC
Q 040325 56 EFVTFGFSMATGVDFAIFSIYSWEFNSSLEM 86 (152)
Q Consensus 56 e~v~VGFSasTG~~~~~h~ilsWsF~~~~~~ 86 (152)
.-+.|=|..+++..+..+..++|+|....-.
T Consensus 279 ~~~nvSFG~~gDgfY~~t~ylsWt~~~G~G~ 309 (350)
T PF15065_consen 279 QGLNVSFGTSGDGFYWATNYLSWTFLIGYGS 309 (350)
T ss_pred EEEEEEeccCCCCcccccceEEEEEecccCC
Confidence 3488889999999999999999999987443
No 9
>KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport]
Probab=96.23 E-value=0.016 Score=49.29 Aligned_cols=59 Identities=24% Similarity=0.146 Sum_probs=43.2
Q ss_pred EEEEEeeCCCCeEEEEEEcCCCCCcccceeEEeecCCC-CCCCceEEEEEeecCCcceeEEEEeeee
Q 040325 15 EAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQ-HLPEFVTFGFSMATGVDFAIFSIYSWEF 80 (152)
Q Consensus 15 ~awI~Yd~~~~~L~V~l~~~~~~~p~~p~Ls~~vdLs~-~L~e~v~VGFSasTG~~~~~h~ilsWsF 80 (152)
..-|.|+. +.|++.....+ |. ....-.++.. .||.--|+|+||+||...+.|.|.+-.+
T Consensus 213 ~~~iry~~--~~l~~~~dl~~---~~--~~~~c~~~n~v~lp~g~~fg~SasTGdlSd~HdivS~kl 272 (351)
T KOG3839|consen 213 LVVIRYEK--KTLSISIDLEG---PN--EWIDCFSLNNVELPLGYFFGVSASTGDLSDSHDIVSLKL 272 (351)
T ss_pred eeEEEecC--CceEEEEecCC---Cc--eeeeeeeecceecccceEEeeeeccCccchhhHHHHhhh
Confidence 46688988 66667665443 21 3444556666 4788889999999999999999998744
No 10
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]. This entry represents the highly conserved transmembrane alpha-helical domain found in these proteins [, ]. The full-length AXL2 protein has a negative regulatory function in cytokinesis [].
Probab=96.20 E-value=0.0092 Score=35.72 Aligned_cols=30 Identities=17% Similarity=0.156 Sum_probs=12.0
Q ss_pred eeeEEEehhHHHHHHHHHHHHhhheeeeEEEec
Q 040325 104 ITALVMGLCLGGGFLVGGVVLIIWLAGIGRKRK 136 (152)
Q Consensus 104 ~~~l~vgl~v~~~~ll~~~~~~~~~~~~~rr~~ 136 (152)
...+++|+.+..+++++++ ++++ ++|+||+
T Consensus 10 ~vaIa~~VvVPV~vI~~vl-~~~l--~~~~rR~ 39 (40)
T PF08693_consen 10 TVAIAVGVVVPVGVIIIVL-GAFL--FFWYRRK 39 (40)
T ss_pred eEEEEEEEEechHHHHHHH-HHHh--heEEecc
Confidence 3344444444333333333 3333 3445443
No 11
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain. The vesicular integral protein of 36 kDa (VIP36) is a type 1 transmembrane protein of the mammalian early secretory pathway that acts as a cargo receptor transporting high mannose type glycoproteins between the Golgi and the endoplasmic reticulum (ER). Lectins of the early secretory pathway are involved in the selective transport of newly synthesized glycoproteins from the ER to the ER-Golgi intermediate compartment (ERGIC). The most prominent cycling lectin is the mannose-binding type1 membrane protein ERGIC-53, which functions as a cargo receptor to facilitate export of glycoproteins from the ER. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded she
Probab=96.15 E-value=0.039 Score=45.08 Aligned_cols=67 Identities=25% Similarity=0.173 Sum_probs=43.8
Q ss_pred CCceEEEEEEeeCCCCeEEEEEEcCCCCCcccceeEEeecCCCCCCCceEEEEEeecCCcceeEEEEeeeeee
Q 040325 10 SGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNS 82 (152)
Q Consensus 10 sG~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~Ls~~vdLs~~L~e~v~VGFSasTG~~~~~h~ilsWsF~~ 82 (152)
.+.+.+++|.|... .+.|.+...+... -..++. .+ .-.||..-|+||||+||...+.|.|++-.+..
T Consensus 156 ~~~~t~~rI~Y~~~--~l~v~vd~~~~~~-w~~Cf~--~~-~v~LP~~~yfGiSA~Tg~~sd~hdIlsv~~~~ 222 (248)
T cd06901 156 KDHDTFVAIRYSKG--RLTVMTDIDGKNE-WKECFD--VT-GVRLPTGYYFGASAATGDLSDNHDIISMKLYE 222 (248)
T ss_pred CCCCeEEEEEEECC--eEEEEEecCCCCc-eeeeEE--eC-CeecCCCCEEEEEecCCCCCCcEEEEEEEEec
Confidence 34456789999974 5777775322101 011222 11 22478889999999999999999999877654
No 12
>KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport]
Probab=95.89 E-value=0.038 Score=48.20 Aligned_cols=66 Identities=26% Similarity=0.192 Sum_probs=48.6
Q ss_pred eEEEEEEeeCCCCeEEEEEEcCCCCCcccceeEEeecCCC-CCCCceEEEEEeecCCcceeEEEEeee-eeeC
Q 040325 13 RNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQ-HLPEFVTFGFSMATGVDFAIFSIYSWE-FNSS 83 (152)
Q Consensus 13 ~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~Ls~~vdLs~-~L~e~v~VGFSasTG~~~~~h~ilsWs-F~~~ 83 (152)
+..|.|+|=+ ++|+|.+.....+. ..+-+... ... .||..-|+|.|||||....-|.|++.. |+.+
T Consensus 189 PvRarItY~~--nvLtv~innGmtp~-d~yE~C~r--ve~~~lp~nGyFGvSAATGgLADDHDVl~FltfsL~ 256 (497)
T KOG3838|consen 189 PVRARITYYG--NVLTVMINNGMTPS-DDYEFCVR--VENLLLPPNGYFGVSAATGGLADDHDVLSFLTFSLS 256 (497)
T ss_pred CceEEEEEec--cEEEEEEcCCCCCC-CCcceeEe--ccceeccCCCeeeeeecccccccccceeeeEEeeec
Confidence 6789999987 78999997543212 22334433 334 578999999999999999999999984 4444
No 13
>PF06697 DUF1191: Protein of unknown function (DUF1191); InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function.
Probab=95.20 E-value=0.11 Score=43.30 Aligned_cols=11 Identities=36% Similarity=0.456 Sum_probs=4.9
Q ss_pred EEehhHHHHHH
Q 040325 108 VMGLCLGGGFL 118 (152)
Q Consensus 108 ~vgl~v~~~~l 118 (152)
++|+.+|.+++
T Consensus 216 v~g~~~G~~~L 226 (278)
T PF06697_consen 216 VVGVVGGVVLL 226 (278)
T ss_pred EEEehHHHHHH
Confidence 44544444433
No 14
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=93.96 E-value=0.091 Score=40.16 Aligned_cols=13 Identities=31% Similarity=0.529 Sum_probs=5.4
Q ss_pred ehhHHHHHHHHHH
Q 040325 110 GLCLGGGFLVGGV 122 (152)
Q Consensus 110 gl~v~~~~ll~~~ 122 (152)
.+++|++++++++
T Consensus 55 VVGVGg~ill~il 67 (154)
T PF04478_consen 55 VVGVGGPILLGIL 67 (154)
T ss_pred EecccHHHHHHHH
Confidence 3334444444333
No 15
>PTZ00382 Variant-specific surface protein (VSP); Provisional
Probab=92.74 E-value=0.13 Score=36.28 Aligned_cols=30 Identities=23% Similarity=0.264 Sum_probs=14.5
Q ss_pred eeeEEEehhHHHHHHHHHHHHhhheeeeEE
Q 040325 104 ITALVMGLCLGGGFLVGGVVLIIWLAGIGR 133 (152)
Q Consensus 104 ~~~l~vgl~v~~~~ll~~~~~~~~~~~~~r 133 (152)
+.+.++|+.+++++++.+++++++|.|++|
T Consensus 64 s~gaiagi~vg~~~~v~~lv~~l~w~f~~r 93 (96)
T PTZ00382 64 STGAIAGISVAVVAVVGGLVGFLCWWFVCR 93 (96)
T ss_pred ccccEEEEEeehhhHHHHHHHHHhheeEEe
Confidence 345566666665554444434444414444
No 16
>PF15102 TMEM154: TMEM154 protein family
Probab=92.73 E-value=0.26 Score=37.43 Aligned_cols=17 Identities=18% Similarity=-0.181 Sum_probs=8.4
Q ss_pred eEEEehhHHHHHHHHHH
Q 040325 106 ALVMGLCLGGGFLVGGV 122 (152)
Q Consensus 106 ~l~vgl~v~~~~ll~~~ 122 (152)
.+.|++++.++++++++
T Consensus 58 iLmIlIP~VLLvlLLl~ 74 (146)
T PF15102_consen 58 ILMILIPLVLLVLLLLS 74 (146)
T ss_pred EEEEeHHHHHHHHHHHH
Confidence 45566664444443333
No 17
>PHA03265 envelope glycoprotein D; Provisional
Probab=88.19 E-value=0.21 Score=43.04 Aligned_cols=29 Identities=28% Similarity=0.412 Sum_probs=18.5
Q ss_pred eeeEEEehhHHHHHHHHHHHHhhheeeeEEEecc
Q 040325 104 ITALVMGLCLGGGFLVGGVVLIIWLAGIGRKRKD 137 (152)
Q Consensus 104 ~~~l~vgl~v~~~~ll~~~~~~~~~~~~~rr~~~ 137 (152)
-++++||+++++++++ |++.+ ++|||||.
T Consensus 349 ~~g~~ig~~i~glv~v----g~il~-~~~rr~k~ 377 (402)
T PHA03265 349 FVGISVGLGIAGLVLV----GVILY-VCLRRKKE 377 (402)
T ss_pred ccceEEccchhhhhhh----hHHHH-HHhhhhhh
Confidence 3567778777665554 55555 67777654
No 18
>PF01299 Lamp: Lysosome-associated membrane glycoprotein (Lamp); InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below. +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+ In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100. Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail. Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=86.67 E-value=0.49 Score=39.49 Aligned_cols=31 Identities=19% Similarity=0.311 Sum_probs=15.6
Q ss_pred EEEehhHHHHHHHHHHHHhhheeeeEEEeccC
Q 040325 107 LVMGLCLGGGFLVGGVVLIIWLAGIGRKRKDG 138 (152)
Q Consensus 107 l~vgl~v~~~~ll~~~~~~~~~~~~~rr~~~~ 138 (152)
.++.+.||++++.++++++++| ++.|||.+.
T Consensus 271 ~~vPIaVG~~La~lvlivLiaY-li~Rrr~~~ 301 (306)
T PF01299_consen 271 DLVPIAVGAALAGLVLIVLIAY-LIGRRRSRA 301 (306)
T ss_pred chHHHHHHHHHHHHHHHHHHhh-eeEeccccc
Confidence 4444444444433333255566 666666554
No 19
>PF14610 DUF4448: Protein of unknown function (DUF4448)
Probab=86.30 E-value=0.58 Score=36.38 Aligned_cols=28 Identities=18% Similarity=0.063 Sum_probs=14.7
Q ss_pred eEEEehhHHHHHHHHHHHHhhheeeeEEEecc
Q 040325 106 ALVMGLCLGGGFLVGGVVLIIWLAGIGRKRKD 137 (152)
Q Consensus 106 ~l~vgl~v~~~~ll~~~~~~~~~~~~~rr~~~ 137 (152)
.++|+|++.++++++ ++.++ ++|.||+|
T Consensus 159 ~laI~lPvvv~~~~~---~~~~~-~~~~R~~R 186 (189)
T PF14610_consen 159 ALAIALPVVVVVLAL---IMYGF-FFWNRKKR 186 (189)
T ss_pred eEEEEccHHHHHHHH---HHHhh-heeeccce
Confidence 677777776555443 33333 44544433
No 20
>cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain. This family includes bacterial proteins homologous to the VcfQ (also known as MshQ) bacterial pilus biogenesis protein. VcfQ is encoded by the vcfQ gene of the type IV pilus gene cluster of Vibrio cholerae and is essential for type IV pilus assembly. VcfQ has a Laminin G-like domain as well as an L-type lectin domain.
Probab=85.39 E-value=4.6 Score=33.33 Aligned_cols=28 Identities=21% Similarity=0.339 Sum_probs=24.4
Q ss_pred CCCCCceEEEEEeecCCcceeEEEEeee
Q 040325 52 QHLPEFVTFGFSMATGVDFAIFSIYSWE 79 (152)
Q Consensus 52 ~~L~e~v~VGFSasTG~~~~~h~ilsWs 79 (152)
.-+|+..+++|++|||...-.|.|-...
T Consensus 225 ~avP~~f~lS~TgSTGgstN~HEIdnf~ 252 (255)
T cd06900 225 DAIPENFYLSFTGSTGGSTNTHEIDNFQ 252 (255)
T ss_pred CCCCccEEEEEEecCCCcccceeecceE
Confidence 5789999999999999999999886543
No 21
>PF05454 DAG1: Dystroglycan (Dystrophin-associated glycoprotein 1); InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=85.26 E-value=0.26 Score=41.33 Aligned_cols=17 Identities=24% Similarity=0.149 Sum_probs=0.0
Q ss_pred HhhheeeeEEEeccCCcc
Q 040325 124 LIIWLAGIGRKRKDGDEE 141 (152)
Q Consensus 124 ~~~~~~~~~rr~~~~~~~ 141 (152)
+++++ +++||||+||+.
T Consensus 163 ~iIa~-icyrrkR~GK~~ 179 (290)
T PF05454_consen 163 GIIAC-ICYRRKRKGKMS 179 (290)
T ss_dssp ------------------
T ss_pred HHHHH-Hhhhhhhccccc
Confidence 44444 556666666544
No 22
>PF06365 CD34_antigen: CD34/Podocalyxin family; InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins. The CD34 antigen is a human leukocyte membrane protein expressed specifically by lymphohematopoietic progenitor cells. CD34 is a phosphoprotein. Activation of protein kinase C (PKC) has been found to enhance CD34 phosphorylation [, ]. This family contains several eukaryotic podocalyxin proteins. Podocalyxin is a major membrane protein of the glomerular epithelium and is thought to be involved in maintenance of the architecture of the foot processes and filtration slits characteristic of this unique epithelium by virtue of its high negative charge. Podocalyxin functions as an anti-adhesin that maintains an open filtration pathway between neighbouring foot processes in the glomerular epithelium by charge repulsion [].
Probab=85.14 E-value=0.96 Score=36.11 Aligned_cols=28 Identities=18% Similarity=0.154 Sum_probs=15.4
Q ss_pred EEEehhH-HHHHHHHHHHHhhheeeeEEEec
Q 040325 107 LVMGLCL-GGGFLVGGVVLIIWLAGIGRKRK 136 (152)
Q Consensus 107 l~vgl~v-~~~~ll~~~~~~~~~~~~~rr~~ 136 (152)
+.|++.+ |++++++++ +.++| ++|.||.
T Consensus 101 ~lI~lv~~g~~lLla~~-~~~~Y-~~~~Rrs 129 (202)
T PF06365_consen 101 TLIALVTSGSFLLLAIL-LGAGY-CCHQRRS 129 (202)
T ss_pred EEEehHHhhHHHHHHHH-HHHHH-Hhhhhcc
Confidence 5555444 444454444 66666 6776654
No 23
>PF05545 FixQ: Cbb3-type cytochrome oxidase component FixQ; InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=82.20 E-value=0.62 Score=28.53 Aligned_cols=13 Identities=15% Similarity=0.125 Sum_probs=6.5
Q ss_pred HhhheeeeEEEecc
Q 040325 124 LIIWLAGIGRKRKD 137 (152)
Q Consensus 124 ~~~~~~~~~rr~~~ 137 (152)
+++++ .+++|+|+
T Consensus 24 gi~~w-~~~~~~k~ 36 (49)
T PF05545_consen 24 GIVIW-AYRPRNKK 36 (49)
T ss_pred HHHHH-HHcccchh
Confidence 55555 55555443
No 24
>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein).
Probab=80.54 E-value=1.4 Score=38.26 Aligned_cols=30 Identities=27% Similarity=0.300 Sum_probs=21.0
Q ss_pred eeeEEEehhHHHHHHHHHHHHhhheeeeEE
Q 040325 104 ITALVMGLCLGGGFLVGGVVLIIWLAGIGR 133 (152)
Q Consensus 104 ~~~l~vgl~v~~~~ll~~~~~~~~~~~~~r 133 (152)
+.+.++|++|++++++.+||||+.|.|+-|
T Consensus 365 stgaIaGIsvavvvvVgglvGfLcWwf~cr 394 (397)
T PF03302_consen 365 STGAIAGISVAVVVVVGGLVGFLCWWFICR 394 (397)
T ss_pred cccceeeeeehhHHHHHHHHHHHhhheeec
Confidence 567888999988887777767765414444
No 25
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=77.86 E-value=0.39 Score=35.38 Aligned_cols=8 Identities=50% Similarity=0.501 Sum_probs=2.9
Q ss_pred eeEEEecc
Q 040325 130 GIGRKRKD 137 (152)
Q Consensus 130 ~~~rr~~~ 137 (152)
+++|||||
T Consensus 87 ~irR~~Kk 94 (122)
T PF01102_consen 87 CIRRLRKK 94 (122)
T ss_dssp HHHHHS--
T ss_pred HHHHHhcc
Confidence 55444444
No 26
>PF14283 DUF4366: Domain of unknown function (DUF4366)
Probab=74.70 E-value=3.3 Score=33.36 Aligned_cols=25 Identities=24% Similarity=0.187 Sum_probs=18.8
Q ss_pred cccCCCceEEEEEEeeCCCCeEEEEEE
Q 040325 6 SDVKSGRRNEAWISYNSSTHNLSVAFS 32 (152)
Q Consensus 6 ~~l~sG~~~~awI~Yd~~~~~L~V~l~ 32 (152)
+.-++|+.++.-||||.... +|++-
T Consensus 78 v~Tk~gn~FyliIDr~~~~e--nV~fL 102 (218)
T PF14283_consen 78 VTTKSGNTFYLIIDRDEEGE--NVYFL 102 (218)
T ss_pred EEecCCCEEEEEEecCCCcc--eEEEe
Confidence 34578888888888888877 57653
No 27
>PF02480 Herpes_gE: Alphaherpesvirus glycoprotein E; InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=73.91 E-value=1 Score=39.78 Aligned_cols=8 Identities=13% Similarity=0.875 Sum_probs=5.3
Q ss_pred EEEeeeee
Q 040325 74 SIYSWEFN 81 (152)
Q Consensus 74 ~ilsWsF~ 81 (152)
.+..|..+
T Consensus 293 hv~aW~yt 300 (439)
T PF02480_consen 293 HVEAWTYT 300 (439)
T ss_dssp EEEEEEEE
T ss_pred eeeeeEEE
Confidence 45678775
No 28
>PF12877 DUF3827: Domain of unknown function (DUF3827); InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ]. In the majority of cases of pilocytic astrocytomas a tandem duplication produces an in-frame fusion of the gene encoding this protein and the BRAF oncogene. The resulting fusion protein has constitutive BRAF kinase activity and is capable of transforming cells.
Probab=73.16 E-value=3 Score=38.68 Aligned_cols=31 Identities=16% Similarity=0.202 Sum_probs=17.8
Q ss_pred CceeeEEEehhHHHHHHHHHHHHhhheeeeEEE
Q 040325 102 KNITALVMGLCLGGGFLVGGVVLIIWLAGIGRK 134 (152)
Q Consensus 102 ~~~~~l~vgl~v~~~~ll~~~~~~~~~~~~~rr 134 (152)
++..++++|+.+..+++++++ +++++ ++.|+
T Consensus 266 ~~NlWII~gVlvPv~vV~~Ii-iil~~-~LCRk 296 (684)
T PF12877_consen 266 PNNLWIIAGVLVPVLVVLLII-IILYW-KLCRK 296 (684)
T ss_pred CCCeEEEehHhHHHHHHHHHH-HHHHH-HHhcc
Confidence 455677788766555555444 44444 45544
No 29
>PF14575 EphA2_TM: Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A ....
Probab=72.26 E-value=0.74 Score=30.92 Aligned_cols=6 Identities=17% Similarity=-0.241 Sum_probs=2.1
Q ss_pred eeEEEe
Q 040325 130 GIGRKR 135 (152)
Q Consensus 130 ~~~rr~ 135 (152)
+++||+
T Consensus 22 ~~~rr~ 27 (75)
T PF14575_consen 22 VCFRRC 27 (75)
T ss_dssp CCCTT-
T ss_pred EEEeeE
Confidence 344443
No 30
>PF12191 stn_TNFRSF12A: Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain; InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins. Family members are defined based on similarity in their extracellular domain - a region that contains many cysteine residues arranged in a specific repetitive pattern []. The cysteines allow formation of an extended rod-like structure, responsible for ligand binding []. Upon receptor activation, different intracellular signalling complexes are assembled for different members of the TNFR superfamily, depending on their intracellular domains and sequences []. Activation of TNFRs can therefore induce a range of disparate effects, including cell proliferation, differentiation, survival, or apoptotic cell death, depending upon the receptor involved []. TNFRs are widely distributed and play important roles in many crucial biological processes, such as lymphoid and neuronal development, innate and adaptive immunity, and maintenance of cellular homeostasis []. Drugs that manipulate their signalling have potential roles in the prevention and treatment of many diseases, such as viral infections, coronary heart disease, transplant rejection, and immune disease []. TNF receptor 12 (also known as TWEAK receptor, and fibroblast growth factor-inducible-14 (Fn14)) has been implicated in endothelial cell growth and migration []. The receptor may also play a role in cell-matrix interactions [].; PDB: 2KN0_A 2RPJ_A 2KMZ_A 2EQP_A.
Probab=72.23 E-value=1.5 Score=32.55 Aligned_cols=31 Identities=10% Similarity=-0.148 Sum_probs=0.8
Q ss_pred eeEEEehhHHHHHHHHHHHHhhheeeeEEEeccC
Q 040325 105 TALVMGLCLGGGFLVGGVVLIIWLAGIGRKRKDG 138 (152)
Q Consensus 105 ~~l~vgl~v~~~~ll~~~~~~~~~~~~~rr~~~~ 138 (152)
..+.++.++.++++++++ +.++ ++|||.+|+
T Consensus 77 l~~pi~~sal~v~lVl~l--lsg~-lv~rrcrrr 107 (129)
T PF12191_consen 77 LLWPILGSALSVVLVLAL--LSGF-LVWRRCRRR 107 (129)
T ss_dssp SS--------------------------------
T ss_pred eehhhhhhHHHHHHHHHH--HHHH-HHHhhhhcc
Confidence 344444444444443333 2233 445544433
No 31
>PF06024 DUF912: Nucleopolyhedrovirus protein of unknown function (DUF912); InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=71.35 E-value=7.7 Score=27.32 Aligned_cols=8 Identities=38% Similarity=0.372 Sum_probs=3.3
Q ss_pred eeEEEecc
Q 040325 130 GIGRKRKD 137 (152)
Q Consensus 130 ~~~rr~~~ 137 (152)
++.|.|++
T Consensus 85 VILRer~~ 92 (101)
T PF06024_consen 85 VILRERQK 92 (101)
T ss_pred EEEecccc
Confidence 34444433
No 32
>PHA03283 envelope glycoprotein E; Provisional
Probab=67.24 E-value=11 Score=34.26 Aligned_cols=7 Identities=14% Similarity=0.738 Sum_probs=4.0
Q ss_pred EEeeeee
Q 040325 75 IYSWEFN 81 (152)
Q Consensus 75 ilsWsF~ 81 (152)
+..|..+
T Consensus 340 veAW~Yt 346 (542)
T PHA03283 340 PEAWTYT 346 (542)
T ss_pred eeeeEEE
Confidence 4556664
No 33
>PF11770 GAPT: GRB2-binding adapter (GAPT); InterPro: IPR021082 This entry represents a family of transmembrane proteins which bind the growth factor receptor-bound protein 2 (GRB2) in B cells []. In contrast to other transmembrane adaptor proteins, GAPT, which this entry represents, is not phosphorylated upon BCR ligation. It associates with GRB2 constitutively through its proline-rich region [].
Probab=66.79 E-value=2.7 Score=32.15 Aligned_cols=19 Identities=16% Similarity=-0.279 Sum_probs=10.2
Q ss_pred HHHHHHHHHHhhheeeeEEEe
Q 040325 115 GGFLVGGVVLIIWLAGIGRKR 135 (152)
Q Consensus 115 ~~~ll~~~~~~~~~~~~~rr~ 135 (152)
+++++++. |++++ +.||+|
T Consensus 18 Ll~lLl~c-giGcv-whwkhr 36 (158)
T PF11770_consen 18 LLLLLLLC-GIGCV-WHWKHR 36 (158)
T ss_pred HHHHHHHH-hcceE-EEeecc
Confidence 33333333 66666 667764
No 34
>PF15069 FAM163: FAM163 family
Probab=66.25 E-value=7.3 Score=29.49 Aligned_cols=23 Identities=17% Similarity=0.222 Sum_probs=15.1
Q ss_pred eeEEEehhHHHHHHHHHHHHhhhe
Q 040325 105 TALVMGLCLGGGFLVGGVVLIIWL 128 (152)
Q Consensus 105 ~~l~vgl~v~~~~ll~~~~~~~~~ 128 (152)
+.++.|-.++.++||+++ +++++
T Consensus 5 TvVItGgILAtVILLcII-aVLCY 27 (143)
T PF15069_consen 5 TVVITGGILATVILLCII-AVLCY 27 (143)
T ss_pred eEEEechHHHHHHHHHHH-HHHHH
Confidence 455666667777777766 65555
No 35
>PF14851 FAM176: FAM176 family
Probab=65.05 E-value=3.9 Score=31.31 Aligned_cols=16 Identities=25% Similarity=0.385 Sum_probs=8.4
Q ss_pred EEEehhHHHHHHHHHH
Q 040325 107 LVMGLCLGGGFLVGGV 122 (152)
Q Consensus 107 l~vgl~v~~~~ll~~~ 122 (152)
++.|+++|+++.++++
T Consensus 26 Fv~gVC~GLlLtLcll 41 (153)
T PF14851_consen 26 FVSGVCAGLLLTLCLL 41 (153)
T ss_pred HHHHHHHHHHHHHHHH
Confidence 3456665555555444
No 36
>PF13908 Shisa: Wnt and FGF inhibitory regulator
Probab=62.16 E-value=8.4 Score=29.47 Aligned_cols=15 Identities=27% Similarity=0.437 Sum_probs=7.4
Q ss_pred eeeEEEehhHHHHHH
Q 040325 104 ITALVMGLCLGGGFL 118 (152)
Q Consensus 104 ~~~l~vgl~v~~~~l 118 (152)
..++++++.++++++
T Consensus 77 ~~~iivgvi~~Vi~I 91 (179)
T PF13908_consen 77 ITGIIVGVICGVIAI 91 (179)
T ss_pred eeeeeeehhhHHHHH
Confidence 344566665544433
No 37
>PF07213 DAP10: DAP10 membrane protein; InterPro: IPR009861 This family consists of several mammalian DAP10 membrane proteins. In activated mouse natural killer (NK) cells, the NKG2D receptor associates with two intracellular adaptors, DAP10 and DAP12, which trigger phosphatidyl inositol 3 kinase (PI3K) and Syk family protein tyrosine kinases, respectively. It has been suggested that the DAP10-PI3K pathway is sufficient to initiate NKG2D-mediated killing of target cells [].
Probab=58.92 E-value=3.8 Score=28.00 Aligned_cols=18 Identities=17% Similarity=0.250 Sum_probs=8.6
Q ss_pred eeEEEehhHHHHHHHHHH
Q 040325 105 TALVMGLCLGGGFLVGGV 122 (152)
Q Consensus 105 ~~l~vgl~v~~~~ll~~~ 122 (152)
.++.+|+.++=+++-+++
T Consensus 33 ~g~LaGiV~~D~vlTLLI 50 (79)
T PF07213_consen 33 PGLLAGIVAADAVLTLLI 50 (79)
T ss_pred HHHHHHHHHHHHHHHHHH
Confidence 345556655534443333
No 38
>TIGR01478 STEVOR variant surface antigen, stevor family. This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Probab=56.35 E-value=3.1 Score=35.00 Aligned_cols=8 Identities=38% Similarity=0.294 Sum_probs=3.5
Q ss_pred EEEeccCC
Q 040325 132 GRKRKDGD 139 (152)
Q Consensus 132 ~rr~~~~~ 139 (152)
+||||+-+
T Consensus 283 yrrRK~sw 290 (295)
T TIGR01478 283 YRRRKKSW 290 (295)
T ss_pred HHhhcccc
Confidence 44444433
No 39
>PTZ00370 STEVOR; Provisional
Probab=55.13 E-value=3.3 Score=34.84 Aligned_cols=7 Identities=43% Similarity=0.662 Sum_probs=3.1
Q ss_pred EEEeccC
Q 040325 132 GRKRKDG 138 (152)
Q Consensus 132 ~rr~~~~ 138 (152)
+||||+.
T Consensus 279 yrrRK~s 285 (296)
T PTZ00370 279 YRRRKNS 285 (296)
T ss_pred HHhhcch
Confidence 4444443
No 40
>PF02009 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=54.62 E-value=2 Score=36.25 Aligned_cols=7 Identities=43% Similarity=0.249 Sum_probs=2.9
Q ss_pred eeEEEec
Q 040325 130 GIGRKRK 136 (152)
Q Consensus 130 ~~~rr~~ 136 (152)
++||-||
T Consensus 277 LILRYRR 283 (299)
T PF02009_consen 277 LILRYRR 283 (299)
T ss_pred HHHHHHH
Confidence 4444333
No 41
>PF14283 DUF4366: Domain of unknown function (DUF4366)
Probab=52.54 E-value=26 Score=28.21 Aligned_cols=6 Identities=17% Similarity=0.484 Sum_probs=2.2
Q ss_pred EEeecC
Q 040325 62 FSMATG 67 (152)
Q Consensus 62 FSasTG 67 (152)
|....|
T Consensus 78 v~Tk~g 83 (218)
T PF14283_consen 78 VTTKSG 83 (218)
T ss_pred EEecCC
Confidence 333333
No 42
>PF05337 CSF-1: Macrophage colony stimulating factor-1 (CSF-1); InterPro: IPR008001 Colony stimulating factor 1 (CSF-1) is a homodimeric polypeptide growth factor whose primary function is to regulate the survival, proliferation, differentiation, and function of cells of the mononuclear phagocytic lineage. This lineage includes mononuclear phagocytic precursors, blood monocytes, tissue macrophages, osteoclasts, and microglia of the brain, all of which possess cell surface receptors for CSF-1. The protein has also been linked with male fertility [] and mutations in the Csf-1 gene have been found to cause osteopetrosis and failure of tooth eruption [].; GO: 0005125 cytokine activity, 0008083 growth factor activity, 0016021 integral to membrane; PDB: 3EJJ_A.
Probab=49.05 E-value=5.7 Score=33.26 Aligned_cols=17 Identities=24% Similarity=0.038 Sum_probs=0.0
Q ss_pred eEEEehhHHHHHHHHHH
Q 040325 106 ALVMGLCLGGGFLVGGV 122 (152)
Q Consensus 106 ~l~vgl~v~~~~ll~~~ 122 (152)
+++.-+.+..++++++.
T Consensus 225 ~~vf~lLVPSiILVLLa 241 (285)
T PF05337_consen 225 GFVFYLLVPSIILVLLA 241 (285)
T ss_dssp -----------------
T ss_pred cccccccccchhhhhhh
Confidence 45555666665554443
No 43
>PF03229 Alpha_GJ: Alphavirus glycoprotein J; InterPro: IPR004913 The exact function of the herpesvirus glycoprotein J is unknown, but it appears to play a role in the inhibition of apotosis of the host cell [].; GO: 0019050 suppression by virus of host apoptosis
Probab=48.89 E-value=3.9 Score=30.02 Aligned_cols=23 Identities=13% Similarity=0.028 Sum_probs=14.0
Q ss_pred eeEEEehhHHHHHHHHHHHHhhhe
Q 040325 105 TALVMGLCLGGGFLVGGVVLIIWL 128 (152)
Q Consensus 105 ~~l~vgl~v~~~~ll~~~~~~~~~ 128 (152)
..+++++.+|+++++++. ++...
T Consensus 82 ~d~aLp~VIGGLcaL~La-amGA~ 104 (126)
T PF03229_consen 82 VDFALPLVIGGLCALTLA-AMGAG 104 (126)
T ss_pred cccchhhhhhHHHHHHHH-HHHHH
Confidence 446778778776665554 44443
No 44
>PF04689 S1FA: DNA binding protein S1FA; InterPro: IPR006779 S1FA is an unusual small plant peptide of only 70 amino acids with a basic domain which contains a nuclear localization signal and a putative DNA binding helix. S1FA is highly conserved between dicotyledonous and monocotyledonous plants and may be a DNA-binding protein that specifically recognises the negative promoter element S1F [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=45.03 E-value=10 Score=25.02 Aligned_cols=30 Identities=27% Similarity=0.072 Sum_probs=17.7
Q ss_pred eeeEEEehhHHHHHHHHHHHHhhheeeeEEE
Q 040325 104 ITALVMGLCLGGGFLVGGVVLIIWLAGIGRK 134 (152)
Q Consensus 104 ~~~l~vgl~v~~~~ll~~~~~~~~~~~~~rr 134 (152)
+-++++.+.++.+++++++ +-.++|++++|
T Consensus 11 nPGlIVLlvV~g~ll~flv-GnyvlY~Yaqk 40 (69)
T PF04689_consen 11 NPGLIVLLVVAGLLLVFLV-GNYVLYVYAQK 40 (69)
T ss_pred CCCeEEeehHHHHHHHHHH-HHHHHHHHHhh
Confidence 3457777777766665555 44433366665
No 45
>cd01324 cbb3_Oxidase_CcoQ Cytochrome cbb oxidase CcoQ. Cytochrome cbb3 oxidase, the terminal oxidase in the respiratory chains of proteobacteria, is a multi-chain transmembrane protein located in the cell membrane. Like other cytochrome oxidases, it catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. Found exclusively in proteobacteria, cbb3 is believed to be a modern enzyme that has evolved independently to perform a specialized function in microaerobic energy metabolism. The cbb3 operon contains four genes (ccoNOQP or fixNOQP), with ccoN coding for subunit I. Instead of a CuA-containing subunit II analogous to other cytochrome oxidases, cbb3 utilizes subunits ccoO and ccoP, which contain one and two hemes, respectively, to transfer electrons to the binuclear center. ccoQ, the fourth subunit, is a single transmembrane helix protein. It has been shown to protect the core complex from proteolytic degradation by serine proteases. See cd00919, cd01322
Probab=44.58 E-value=12 Score=23.01 Aligned_cols=14 Identities=14% Similarity=0.143 Sum_probs=7.8
Q ss_pred HhhheeeeEEEeccC
Q 040325 124 LIIWLAGIGRKRKDG 138 (152)
Q Consensus 124 ~~~~~~~~~rr~~~~ 138 (152)
+++++ .+++|+|++
T Consensus 25 giv~w-a~~p~~k~~ 38 (48)
T cd01324 25 GVVVW-AFRPGRKKA 38 (48)
T ss_pred HHHHH-HhCCCcchh
Confidence 55555 566655544
No 46
>PLN03150 hypothetical protein; Provisional
Probab=43.80 E-value=25 Score=32.23 Aligned_cols=29 Identities=14% Similarity=0.170 Sum_probs=12.0
Q ss_pred eEEEehhHHHHHHHHHHHHhhheeeeEEEec
Q 040325 106 ALVMGLCLGGGFLVGGVVLIIWLAGIGRKRK 136 (152)
Q Consensus 106 ~l~vgl~v~~~~ll~~~~~~~~~~~~~rr~~ 136 (152)
...+++.++++++++++ .+..+ ++||||+
T Consensus 544 ~~~i~~~~~~~~~~l~~-~~~~~-~~~~~r~ 572 (623)
T PLN03150 544 GAKIGIAFGVSVAFLFL-VICAM-CWWKRRQ 572 (623)
T ss_pred ceEEEEEhHHHHHHHHH-HHHHh-hheeehh
Confidence 44455444444333333 22223 4455543
No 47
>TIGR01433 CyoA cytochrome o ubiquinol oxidase subunit II. This enzyme catalyzes the oxidation of ubiquinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. Subunit II is responsible for binding and oxidation of the ubiquinone substrate. This sequence is closely related to QoxA, which oxidizes quinol in gram positive bacteria but which is in complex with subunits which utilize cytochromes a in the reduction of molecular oxygen. Slightly more distantly related is subunit II of cytochrome c oxidase which uses cyt. c as the oxidant.
Probab=42.80 E-value=36 Score=27.36 Aligned_cols=14 Identities=14% Similarity=0.062 Sum_probs=7.0
Q ss_pred HhhheeeeEEEeccC
Q 040325 124 LIIWLAGIGRKRKDG 138 (152)
Q Consensus 124 ~~~~~~~~~rr~~~~ 138 (152)
+++++ +.+|.|+++
T Consensus 48 ~~~~~-~~~r~r~~~ 61 (226)
T TIGR01433 48 LMTLF-FAWKYRATN 61 (226)
T ss_pred HHHhe-eeEEEeccC
Confidence 44444 556655443
No 48
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=42.11 E-value=13 Score=24.11 Aligned_cols=12 Identities=17% Similarity=0.409 Sum_probs=5.1
Q ss_pred HhhheeeeEEEec
Q 040325 124 LIIWLAGIGRKRK 136 (152)
Q Consensus 124 ~~~~~~~~~rr~~ 136 (152)
+++++ .+++++|
T Consensus 24 avi~~-ayr~~~K 35 (60)
T COG4736 24 AVIYF-AYRPGKK 35 (60)
T ss_pred HHHHH-Hhcccch
Confidence 44444 4444333
No 49
>PF08114 PMP1_2: ATPase proteolipid family; InterPro: IPR012589 This family consists of small proteolipids associated with the plasma membrane H+ ATPase. Two proteolipids (PMP1 and PMP2) are associated with the ATPase and both genes are similarly expressed in the wild-type strain of yeast. No modification of the level of transcription of one PMP gene is detected in a strain deleted of the other. Though both proteolipids show similarity with other small proteolipids associated with other cation -transporting ATPases, their functions remain unclear [].
Probab=41.06 E-value=2 Score=25.81 Aligned_cols=14 Identities=36% Similarity=0.107 Sum_probs=7.1
Q ss_pred HhhheeeeEEEeccC
Q 040325 124 LIIWLAGIGRKRKDG 138 (152)
Q Consensus 124 ~~~~~~~~~rr~~~~ 138 (152)
++++. +++||+..|
T Consensus 23 ~iva~-~iYRKw~aR 36 (43)
T PF08114_consen 23 GIVAL-FIYRKWQAR 36 (43)
T ss_pred HHHHH-HHHHHHHHH
Confidence 44444 556665443
No 50
>TIGR01495 ETRAMP Plasmodium ring stage membrane protein ETRAMP. These genes have been shown to be found in the sub-telomeric regions of both P. falciparum and P. yoelii chromosomes.
Probab=38.64 E-value=21 Score=24.57 Aligned_cols=6 Identities=0% Similarity=0.229 Sum_probs=2.3
Q ss_pred eeEEEe
Q 040325 105 TALVMG 110 (152)
Q Consensus 105 ~~l~vg 110 (152)
+.+.+.
T Consensus 50 K~i~iS 55 (85)
T TIGR01495 50 KIILYS 55 (85)
T ss_pred ceeehH
Confidence 334433
No 51
>PF11353 DUF3153: Protein of unknown function (DUF3153); InterPro: IPR021499 This family of proteins with unknown function appear to be restricted to Cyanobacteria. Some members are annotated as membrane proteins however this cannot be confirmed.
Probab=38.43 E-value=83 Score=24.67 Aligned_cols=28 Identities=32% Similarity=0.363 Sum_probs=16.8
Q ss_pred ccceeEEeecCCCCCC-CceEEEEEeecC
Q 040325 40 VMQGLDYQVDLRQHLP-EFVTFGFSMATG 67 (152)
Q Consensus 40 ~~p~Ls~~vdLs~~L~-e~v~VGFSasTG 67 (152)
.++.|...+||+..-. +..-+-|+=++.
T Consensus 115 ~~~~L~~~lDL~~L~~~~~ldl~f~l~~P 143 (209)
T PF11353_consen 115 VRYRLDLDLDLRSLPDLPGLDLEFSLSTP 143 (209)
T ss_pred EEEEEEEEeehhhcCCCCcceEEEEEeCC
Confidence 3455888899987643 223555555543
No 52
>PF15099 PIRT: Phosphoinositide-interacting protein family
Probab=37.39 E-value=11 Score=27.97 Aligned_cols=8 Identities=38% Similarity=0.418 Sum_probs=5.4
Q ss_pred EEEeecCC
Q 040325 61 GFSMATGV 68 (152)
Q Consensus 61 GFSasTG~ 68 (152)
..+++||.
T Consensus 36 ~lt~atgg 43 (129)
T PF15099_consen 36 QLTAATGG 43 (129)
T ss_pred HHhccCCC
Confidence 45778775
No 53
>TIGR03370 PEPCTERM_Roseo variant PEP-CTERM putative exosortase signal, Roseobacter type. A probable protein export sorting signal, PEP-CTERM, was described by Haft, et al. (PubMed:16930487). It is predicted to interact with a putative transpeptidase we designate exosortase. Most examples of this signal are recognized by model TIGR02595, but some unusual clades require different models. This model describes a variant with conserved motif VPLPA, rather than VPEP. This variant is found prominently in two members of the Rhodobacterales, namely Jannaschia sp. CCS1 and Roseobacter denitrificans OCh 114. One interesting member protein has a full-length duplication and therefore two copies of this putative sorting domain.
Probab=37.22 E-value=5.6 Score=21.56 Aligned_cols=8 Identities=25% Similarity=0.534 Sum_probs=3.0
Q ss_pred HHHHHHHH
Q 040325 115 GGFLVGGV 122 (152)
Q Consensus 115 ~~~ll~~~ 122 (152)
+..++.++
T Consensus 7 ~~LLl~gL 14 (26)
T TIGR03370 7 ALLLLAGL 14 (26)
T ss_pred HHHHHHHH
Confidence 33333333
No 54
>PHA02104 hypothetical protein
Probab=36.13 E-value=23 Score=23.93 Aligned_cols=17 Identities=29% Similarity=0.405 Sum_probs=14.7
Q ss_pred ccCCCceEEEEEEeeCC
Q 040325 7 DVKSGRRNEAWISYNSS 23 (152)
Q Consensus 7 ~l~sG~~~~awI~Yd~~ 23 (152)
.-.+|+.+.|.||||+.
T Consensus 54 fa~~gkiynatidynak 70 (89)
T PHA02104 54 FAQNGKIYNATIDYNAK 70 (89)
T ss_pred ehhCCeEEeeEEccCce
Confidence 45789999999999984
No 55
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16. Synaptotagmin 14 and 16 are membrane-trafficking proteins in specific tissues outside the brain. Both of these contain C-terminal tandem C2 repeats, but only Synaptotagmin 14 has an N-terminal transmembrane domain and a putative fatty-acylation site. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium and this is indeed the case here. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B). C2B also regulates also the recycling step of synaptic vesicle
Probab=35.75 E-value=60 Score=22.97 Aligned_cols=21 Identities=19% Similarity=0.295 Sum_probs=18.7
Q ss_pred eEEEEEEeeCCCCeEEEEEEc
Q 040325 13 RNEAWISYNSSTHNLSVAFSG 33 (152)
Q Consensus 13 ~~~awI~Yd~~~~~L~V~l~~ 33 (152)
.++..+.||..+.+|.|++-.
T Consensus 4 ~l~~sl~Y~~~~~~L~V~Vi~ 24 (124)
T cd08389 4 DLDVAFEYDPSARKLTVTVIR 24 (124)
T ss_pred EEEEEEEECCCCCEEEEEEEE
Confidence 478999999999999999973
No 56
>PF06809 NPDC1: Neural proliferation differentiation control-1 protein (NPDC1); InterPro: IPR009635 This family consists of several neural proliferation differentiation control-1 (NPDC1) proteins. NPDC1 plays a role in the control of neural cell proliferation and differentiation. It has been suggested that NPDC1 may be involved in the development of several secretion glands. This family also contains the C-terminal region of the Caenorhabditis elegans protein CAB-1 (Q93249 from SWISSPROT) which is known to interact with AEX-3 [].; GO: 0016021 integral to membrane
Probab=35.36 E-value=92 Score=26.77 Aligned_cols=7 Identities=57% Similarity=0.876 Sum_probs=4.0
Q ss_pred eEEEEEe
Q 040325 58 VTFGFSM 64 (152)
Q Consensus 58 v~VGFSa 64 (152)
...|||.
T Consensus 144 ~tl~~s~ 150 (341)
T PF06809_consen 144 ATLGFSE 150 (341)
T ss_pred ccccccc
Confidence 5566664
No 57
>PHA03264 envelope glycoprotein D; Provisional
Probab=35.08 E-value=84 Score=27.66 Aligned_cols=18 Identities=6% Similarity=0.180 Sum_probs=10.6
Q ss_pred eeEEEehhHHHHHHHHHH
Q 040325 105 TALVMGLCLGGGFLVGGV 122 (152)
Q Consensus 105 ~~l~vgl~v~~~~ll~~~ 122 (152)
..+.+|+.++..++++++
T Consensus 360 ~~~~vg~~~a~~~i~~~a 377 (416)
T PHA03264 360 RPVIVGTGIAAAAIACVA 377 (416)
T ss_pred ceeeeehhhhHHHHHHHh
Confidence 456677777665555433
No 58
>PF05393 Hum_adeno_E3A: Human adenovirus early E3A glycoprotein; InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2.; GO: 0016021 integral to membrane
Probab=34.92 E-value=12 Score=26.12 Aligned_cols=6 Identities=33% Similarity=0.235 Sum_probs=2.3
Q ss_pred eeEEEe
Q 040325 130 GIGRKR 135 (152)
Q Consensus 130 ~~~rr~ 135 (152)
+.+++|
T Consensus 53 vCC~kR 58 (94)
T PF05393_consen 53 VCCKKR 58 (94)
T ss_pred HHHHHh
Confidence 334433
No 59
>PF12248 Methyltransf_FA: Farnesoic acid 0-methyl transferase; InterPro: IPR022041 This domain, found in farnesoic acid O-methyl transferase, is approximately 110 amino acids in length. Farnesoic acid O-methyl transferase (FAMeT) is the enzyme that catalyses the formation of methyl farnesoate (MF) from farnesoic acid (FA) in the biosynthetic pathway of juvenile hormone (JH) [].
Probab=34.42 E-value=1.6e+02 Score=20.34 Aligned_cols=46 Identities=20% Similarity=0.276 Sum_probs=30.4
Q ss_pred cCCCceEEEEEEeeCCCCeEEEEEEcCCCCCcccceeEEeecCCCCCCCceEEEEE
Q 040325 8 VKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFS 63 (152)
Q Consensus 8 l~sG~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~Ls~~vdLs~~L~e~v~VGFS 63 (152)
|...+...-||.+++ ..+.|.... -..|+|+.. |-. -..--|||||
T Consensus 49 ls~~e~~~fwI~~~~--G~I~vg~~g-----~~~pfl~~~-Dp~--~~~v~yvGft 94 (102)
T PF12248_consen 49 LSPSEFRMFWISWRD--GTIRVGRGG-----EDEPFLEWT-DPE--PIPVNYVGFT 94 (102)
T ss_pred CCCCccEEEEEEECC--CEEEEEECC-----CccEEEEEE-CCC--CCcccEEEEe
Confidence 466778888999665 566666542 235688877 433 4466799994
No 60
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length. SHD of Slp (except for the Slp4-SHD) function as a specific Rab27A/B-binding domain. In addition to Slp, rabphilin, Noc2, and Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp4/granuphilin promotes dense-core vesicle exocytosis. The C2A domain of Slp4 is Ca2+ dependent. Slp5 mRNA has been shown to be restricted to human placenta and liver suggesting a role in Rab27A-dependent membrane trafficking in specific tissues. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2
Probab=33.83 E-value=67 Score=22.77 Aligned_cols=23 Identities=30% Similarity=0.330 Sum_probs=19.5
Q ss_pred CCceEEEEEEeeCCCCeEEEEEEc
Q 040325 10 SGRRNEAWISYNSSTHNLSVAFSG 33 (152)
Q Consensus 10 sG~~~~awI~Yd~~~~~L~V~l~~ 33 (152)
+|+ ++..+.|+....+|.|++-.
T Consensus 1 ~G~-i~~sl~y~~~~~~L~V~Vi~ 23 (125)
T cd04029 1 SGE-ILFSLSYDYKTQSLNVHVKE 23 (125)
T ss_pred CcE-EEEEEEEECCCCeEEEEEEE
Confidence 355 68999999999999999974
No 61
>PF02480 Herpes_gE: Alphaherpesvirus glycoprotein E; InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=33.19 E-value=14 Score=32.70 Aligned_cols=6 Identities=33% Similarity=0.612 Sum_probs=0.0
Q ss_pred HHHHHH
Q 040325 114 GGGFLV 119 (152)
Q Consensus 114 ~~~~ll 119 (152)
++++++
T Consensus 360 gvavli 365 (439)
T PF02480_consen 360 GVAVLI 365 (439)
T ss_dssp ------
T ss_pred HHHHHH
Confidence 333333
No 62
>PF13619 KTSC: KTSC domain
Probab=32.45 E-value=61 Score=20.26 Aligned_cols=19 Identities=26% Similarity=0.431 Sum_probs=16.4
Q ss_pred EEEEeeCCCCeEEEEEEcC
Q 040325 16 AWISYNSSTHNLSVAFSGL 34 (152)
Q Consensus 16 awI~Yd~~~~~L~V~l~~~ 34 (152)
..|.||..++.|.|.+...
T Consensus 7 ~~v~Yd~~~~~L~V~F~~G 25 (60)
T PF13619_consen 7 RSVGYDPETRTLEVEFKSG 25 (60)
T ss_pred cEEeECCCCCEEEEEEcCC
Confidence 5699999999999999643
No 63
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=32.38 E-value=27 Score=26.80 Aligned_cols=7 Identities=14% Similarity=0.097 Sum_probs=2.8
Q ss_pred EEEehhH
Q 040325 107 LVMGLCL 113 (152)
Q Consensus 107 l~vgl~v 113 (152)
+.+|+++
T Consensus 56 VGVGg~i 62 (154)
T PF04478_consen 56 VGVGGPI 62 (154)
T ss_pred ecccHHH
Confidence 3444443
No 64
>PF06422 PDR_CDR: CDR ABC transporter; InterPro: IPR010929 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain []. The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). In yeast, the PDR and CDR ABC transporters display extensive sequence homology, and confer resistance to several anti-fungal compounds by actively transporting their substrates out of the cell. These transporters have two homologous halves, each with an N-terminal intracellular hydrophilic region that contains an ATP-binding site, followed by a C-terminal membrane-associated region containing six transmembrane segments []. This entry represents a domain of the PDR/CDR ABC transporter comprising extracellular loop 3, transmembrane segment 6 and a linker region.; GO: 0005524 ATP binding, 0042626 ATPase activity, coupled to transmembrane movement of substances, 0006810 transport, 0016021 integral to membrane
Probab=31.03 E-value=37 Score=23.82 Aligned_cols=14 Identities=7% Similarity=0.019 Sum_probs=6.5
Q ss_pred EehhHHHHHHHHHH
Q 040325 109 MGLCLGGGFLVGGV 122 (152)
Q Consensus 109 vgl~v~~~~ll~~~ 122 (152)
+|+.++.+++++++
T Consensus 52 ~GIli~f~i~f~~~ 65 (103)
T PF06422_consen 52 FGILIAFWIFFIVL 65 (103)
T ss_pred HHHHHHHHHHHHHH
Confidence 45555544444333
No 65
>PF02404 SCF: Stem cell factor; InterPro: IPR003452 Stem cell factor (SCF) is a homodimer involved in hematopoiesis. SCF binds to and activates the SCF receptor (SCFR), a receptor tyrosine kinase. SCF stimulates the proliferation of mast cells and is able to augment the proliferation of both myeloid and lymphoid hematopoietic progenitors in bone marrow culture. It also mediates cell-cell adhesion and acts synergistically with other cytokines. SCF is a type I membrane protein, but is also found in a secretable, soluble form. The crystal structure of human SCF has been resolved and a potential receptor-binding site identified [].; GO: 0005173 stem cell factor receptor binding, 0007155 cell adhesion, 0016020 membrane; PDB: 1EXZ_A 1SCF_D 2E9W_C 2O26_A 2O27_A.
Probab=30.98 E-value=16 Score=30.35 Aligned_cols=8 Identities=13% Similarity=0.031 Sum_probs=0.0
Q ss_pred eeEEEecc
Q 040325 130 GIGRKRKD 137 (152)
Q Consensus 130 ~~~rr~~~ 137 (152)
++|||+++
T Consensus 235 l~WKkkq~ 242 (273)
T PF02404_consen 235 LYWKKKQR 242 (273)
T ss_dssp --------
T ss_pred HHHHhhcc
Confidence 67777654
No 66
>PF15048 OSTbeta: Organic solute transporter subunit beta protein
Probab=30.24 E-value=31 Score=25.56 Aligned_cols=6 Identities=33% Similarity=0.933 Sum_probs=3.9
Q ss_pred eeeeeC
Q 040325 78 WEFNSS 83 (152)
Q Consensus 78 WsF~~~ 83 (152)
|.|...
T Consensus 25 W~fR~E 30 (125)
T PF15048_consen 25 WFFRVE 30 (125)
T ss_pred HheecC
Confidence 777654
No 67
>PF05568 ASFV_J13L: African swine fever virus J13L protein; InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=29.88 E-value=19 Score=27.62 Aligned_cols=7 Identities=43% Similarity=0.496 Sum_probs=2.7
Q ss_pred eeEEEec
Q 040325 130 GIGRKRK 136 (152)
Q Consensus 130 ~~~rr~~ 136 (152)
|..||||
T Consensus 52 cssRKkK 58 (189)
T PF05568_consen 52 CSSRKKK 58 (189)
T ss_pred HhhhhHH
Confidence 3334333
No 68
>PF11857 DUF3377: Domain of unknown function (DUF3377); InterPro: IPR021805 This domain is functionally uncharacterised and found at the C terminus of peptidases belonging to MEROPS peptidase family M10A, membrane-type matrix metallopeptidases (clan MA). ; GO: 0004222 metalloendopeptidase activity
Probab=27.49 E-value=69 Score=21.61 Aligned_cols=12 Identities=8% Similarity=-0.042 Sum_probs=4.9
Q ss_pred hhHHHHHHHHHH
Q 040325 111 LCLGGGFLVGGV 122 (152)
Q Consensus 111 l~v~~~~ll~~~ 122 (152)
+.+..+++++++
T Consensus 34 VviPl~L~LCiL 45 (74)
T PF11857_consen 34 VVIPLVLLLCIL 45 (74)
T ss_pred EeHHHHHHHHHH
Confidence 333344444444
No 69
>PF11225 DUF3024: Protein of unknown function (DUF3024); InterPro: IPR021388 This entry is represented by Bacteriophage 933W, L0084. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=27.05 E-value=54 Score=20.54 Aligned_cols=21 Identities=10% Similarity=0.126 Sum_probs=18.2
Q ss_pred EEEEEeeCCCCeEEEEEEcCC
Q 040325 15 EAWISYNSSTHNLSVAFSGLR 35 (152)
Q Consensus 15 ~awI~Yd~~~~~L~V~l~~~~ 35 (152)
.|+|.|+.+++...++....+
T Consensus 6 iAk~~~~~~~~~W~lyw~~~~ 26 (57)
T PF11225_consen 6 IAKLTFDKTTGCWKLYWMDHD 26 (57)
T ss_pred eEEEEEeCCCCEEEEEEECCC
Confidence 499999999999999998444
No 70
>PTZ00208 65 kDa invariant surface glycoprotein; Provisional
Probab=26.84 E-value=56 Score=28.96 Aligned_cols=27 Identities=7% Similarity=0.293 Sum_probs=10.9
Q ss_pred EEEehhHHHHHHHHHHHHhhheeeeEEEec
Q 040325 107 LVMGLCLGGGFLVGGVVLIIWLAGIGRKRK 136 (152)
Q Consensus 107 l~vgl~v~~~~ll~~~~~~~~~~~~~rr~~ 136 (152)
+++++.+.+++|++ + .+++| ++.||||
T Consensus 388 i~~avl~p~~il~~-~-~~~~~-~~v~rrr 414 (436)
T PTZ00208 388 IILAVLVPAIILAI-I-AVAFF-IMVKRRR 414 (436)
T ss_pred HHHHHHHHHHHHHH-H-HHHhh-eeeeecc
Confidence 33444444444332 2 33344 4444443
No 71
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains. They are expressed in a variety of organisms and are found in high concentrations in the brain where they seem to be localised mainly at cell-cell contact sites. Their expression seems to be developmentally regulated [].
Probab=26.76 E-value=33 Score=27.77 Aligned_cols=12 Identities=8% Similarity=0.202 Sum_probs=5.1
Q ss_pred eeEEEehhHHHH
Q 040325 105 TALVMGLCLGGG 116 (152)
Q Consensus 105 ~~l~vgl~v~~~ 116 (152)
..+++|+..|.+
T Consensus 37 ~~I~iaiVAG~~ 48 (221)
T PF08374_consen 37 VKIMIAIVAGIM 48 (221)
T ss_pred eeeeeeeecchh
Confidence 344444443433
No 72
>PF02468 PsbN: Photosystem II reaction centre N protein (psbN); InterPro: IPR003398 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection []. This family represents the low molecular weight transmembrane protein PsbN found in PSII. PsbN may have a role in PSII stability, however its actual function unknown. PsbN does not appear to be essential for photoautotrophic growth or normal PSII function.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane
Probab=26.15 E-value=90 Score=18.86 Aligned_cols=8 Identities=25% Similarity=0.231 Sum_probs=3.4
Q ss_pred cCCCCCCC
Q 040325 143 NQGFSEYI 150 (152)
Q Consensus 143 ~~~~~~~~ 150 (152)
.|-+|+.+
T Consensus 35 rDPfeeHe 42 (43)
T PF02468_consen 35 RDPFEEHE 42 (43)
T ss_pred CCcccccC
Confidence 34444433
No 73
>PRK05886 yajC preprotein translocase subunit YajC; Validated
Probab=25.88 E-value=17 Score=26.29 Aligned_cols=11 Identities=9% Similarity=-0.167 Sum_probs=4.6
Q ss_pred HhhheeeeEEEe
Q 040325 124 LIIWLAGIGRKR 135 (152)
Q Consensus 124 ~~~~~~~~~rr~ 135 (152)
++++| ++.|+.
T Consensus 15 ~i~yF-~~iRPQ 25 (109)
T PRK05886 15 GGFMY-FASRRQ 25 (109)
T ss_pred HHHHH-HHccHH
Confidence 33444 444443
No 74
>PRK08455 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=24.87 E-value=67 Score=24.97 Aligned_cols=8 Identities=13% Similarity=-0.131 Sum_probs=3.8
Q ss_pred HhhheeeeE
Q 040325 124 LIIWLAGIG 132 (152)
Q Consensus 124 ~~~~~~~~~ 132 (152)
|++++ ++.
T Consensus 35 G~~~~-~~~ 42 (182)
T PRK08455 35 GVIAM-LLM 42 (182)
T ss_pred HHHHH-HHh
Confidence 55554 443
No 75
>PF15102 TMEM154: TMEM154 protein family
Probab=24.70 E-value=84 Score=23.88 Aligned_cols=6 Identities=17% Similarity=0.002 Sum_probs=2.3
Q ss_pred HHHHHH
Q 040325 117 FLVGGV 122 (152)
Q Consensus 117 ~ll~~~ 122 (152)
++++++
T Consensus 66 VLLvlL 71 (146)
T PF15102_consen 66 VLLVLL 71 (146)
T ss_pred HHHHHH
Confidence 333333
No 76
>TIGR00739 yajC preprotein translocase, YajC subunit. While this protein is part of the preprotein translocase in Escherichia coli, it is not essential for viability or protein secretion. The N-terminus region contains a predicted membrane-spanning region followed by a region consisting almost entirely of residues with charged (acidic, basic, or zwitterionic) side chains. This small protein is about 100 residues in length, and is restricted to bacteria; however, this protein is absent from some lineages, including spirochetes and Mycoplasmas.
Probab=24.62 E-value=27 Score=23.79 Aligned_cols=9 Identities=33% Similarity=0.383 Sum_probs=4.0
Q ss_pred hhheeeeEEE
Q 040325 125 IIWLAGIGRK 134 (152)
Q Consensus 125 ~~~~~~~~rr 134 (152)
+++| +++|.
T Consensus 15 i~yf-~~~rp 23 (84)
T TIGR00739 15 IFYF-LIIRP 23 (84)
T ss_pred HHHH-heech
Confidence 3344 44543
No 77
>PF08869 XisI: XisI protein; InterPro: IPR014968 The fdxN element, along with two other DNA elements, is excised from the chromosome during heterocyst differentiation in cyanobacteria. The xisH as well as the xisF and xisI genes are required []. ; PDB: 3D7Q_A 2NWV_A 2NVM_A 2NLV_B.
Probab=24.52 E-value=47 Score=24.03 Aligned_cols=19 Identities=26% Similarity=0.739 Sum_probs=14.5
Q ss_pred cccCCCceEEEEEEeeCCCCeE
Q 040325 6 SDVKSGRRNEAWISYNSSTHNL 27 (152)
Q Consensus 6 ~~l~sG~~~~awI~Yd~~~~~L 27 (152)
+++++|+ +||.+|++..-+
T Consensus 61 ~dI~dgK---IWIq~d~TE~gI 79 (111)
T PF08869_consen 61 LDIKDGK---IWIQRDGTEDGI 79 (111)
T ss_dssp EEEETTE---EEEEEESSSSHH
T ss_pred EEEECCe---EEEEcCchhhHH
Confidence 4677877 899999986543
No 78
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmins 4 and 11, class 4 synaptotagmins, are located in the brain. Their functions are unknown. They are distinguished from the other synaptotagmins by having and Asp to Ser substitution in their C2A domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence
Probab=24.05 E-value=1.5e+02 Score=21.06 Aligned_cols=22 Identities=23% Similarity=0.104 Sum_probs=19.0
Q ss_pred ceEEEEEEeeCCCCeEEEEEEc
Q 040325 12 RRNEAWISYNSSTHNLSVAFSG 33 (152)
Q Consensus 12 ~~~~awI~Yd~~~~~L~V~l~~ 33 (152)
..++..+.||.....|.|++-.
T Consensus 3 G~l~~~l~y~~~~~~L~V~Vi~ 24 (128)
T cd08388 3 GTLFFSLRYNSEKKALLVNIIE 24 (128)
T ss_pred eEEEEEEEEECCCCEEEEEEEE
Confidence 3478899999999999999973
No 79
>TIGR03503 conserved hypothetical protein TIGR03503. This set of conserved hypothetical protein has a phylogenetic range that closely matches that of TIGR03501, a putative C-terminal protein targeting signal.
Probab=24.02 E-value=59 Score=28.37 Aligned_cols=14 Identities=7% Similarity=0.299 Sum_probs=8.8
Q ss_pred eeEEEEeeeeeeCC
Q 040325 71 AIFSIYSWEFNSSL 84 (152)
Q Consensus 71 ~~h~ilsWsF~~~~ 84 (152)
..+.+.+|-|.++.
T Consensus 278 G~Y~i~~~~~~Tt~ 291 (374)
T TIGR03503 278 GKYRVKGTVFGTTI 291 (374)
T ss_pred eEEEEEEEEEEecC
Confidence 34667777776654
No 80
>KOG3637 consensus Vitronectin receptor, alpha subunit [Extracellular structures]
Probab=23.99 E-value=68 Score=31.61 Aligned_cols=17 Identities=24% Similarity=0.331 Sum_probs=7.7
Q ss_pred eEEEehhHHHHHHHHHH
Q 040325 106 ALVMGLCLGGGFLVGGV 122 (152)
Q Consensus 106 ~l~vgl~v~~~~ll~~~ 122 (152)
+++++..++++++|+++
T Consensus 979 wiIi~svl~GLLlL~ll 995 (1030)
T KOG3637|consen 979 WIIILSVLGGLLLLALL 995 (1030)
T ss_pred eeehHHHHHHHHHHHHH
Confidence 44444444454444433
No 81
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. It is thought to be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues and is Ca2+ independent. Human synaptotagmin 15 has 2 alternatively spliced forms that encode proteins with different C-termini. The larger, SYT15a, contains a N-terminal TM region, a putative fatty-acylation site, and 2 tandem C terminal C2 domains. The smaller, SYT15b, lacks the C-terminal portion of the second C2 domain. Unlike most other synaptotagmins it is nearly absent in the brain and rather is found in the heart, lungs, skeletal muscle, and testis. Synaptotagmin 17 is located in the brain, kidney, and prostate and is thought to be a peripheral membrane protein. Previously all synaptotagmins were thought to be calcium sensors in the regulat
Probab=23.97 E-value=1.3e+02 Score=20.64 Aligned_cols=21 Identities=19% Similarity=0.213 Sum_probs=18.5
Q ss_pred eEEEEEEeeCCCCeEEEEEEc
Q 040325 13 RNEAWISYNSSTHNLSVAFSG 33 (152)
Q Consensus 13 ~~~awI~Yd~~~~~L~V~l~~ 33 (152)
.+++.+.||..+..|.|++-.
T Consensus 2 ~l~~~l~y~~~~~~L~V~v~~ 22 (123)
T cd08390 2 RLWFSVQYDLEEEQLTVSLIK 22 (123)
T ss_pred EEEEEEEECCCCCEEEEEEEE
Confidence 368999999999999999973
No 82
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. There are several classes of Synaptotagmins. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B). C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distin
Probab=23.55 E-value=1.3e+02 Score=20.83 Aligned_cols=20 Identities=20% Similarity=0.145 Sum_probs=17.9
Q ss_pred EEEEEEeeCCCCeEEEEEEc
Q 040325 14 NEAWISYNSSTHNLSVAFSG 33 (152)
Q Consensus 14 ~~awI~Yd~~~~~L~V~l~~ 33 (152)
+++.+.|+....+|.|++-.
T Consensus 3 i~~~l~y~~~~~~L~V~v~~ 22 (134)
T cd00276 3 LLLSLSYLPTAERLTVVVLK 22 (134)
T ss_pred EEEEEEeeCCCCEEEEEEEE
Confidence 68899999999999999873
No 83
>KOG3488 consensus Dolichol phosphate-mannose regulatory protein (DPM2) [Posttranslational modification, protein turnover, chaperones]
Probab=23.16 E-value=35 Score=23.00 Aligned_cols=20 Identities=5% Similarity=0.183 Sum_probs=10.1
Q ss_pred EEEehhHHHHHHHHHHHHhh
Q 040325 107 LVMGLCLGGGFLVGGVVLII 126 (152)
Q Consensus 107 l~vgl~v~~~~ll~~~~~~~ 126 (152)
.++.+++++.++++++++.+
T Consensus 48 yAi~iPvaagl~ll~lig~F 67 (81)
T KOG3488|consen 48 YAITIPVAAGLFLLCLIGTF 67 (81)
T ss_pred HHhhhHHHHHHHHHHHHHHH
Confidence 45566665544444443444
No 84
>PF09307 MHC2-interact: CLIP, MHC2 interacting; InterPro: IPR015386 This domain is found in MHC class II-associated invariant chain (Ii), and in class II invariant chain-associated peptide (CLIP), and is required for association with class II major histocompatibility complex (MHC II) in the MHC II processing pathway []. Ii plays a critical role in the assembly of the MHC, as well as in MHC II antigen processing by stabilising peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place []. In antigen-presenting cells (APCs), loading of MHC II molecules with peptides is regulated by Ii, which blocks MHC II antigen-binding sites in pre-endosomal compartments []. Several factors modulate the surface expression of MHC II molecules via post-Golgi mechanisms, including CLIP. The Invariant chain contains a single transmembrane domain. Ii first assembles into a trimer and then associates with three class II alpha/beta MHC heterodimers. Although the membrane-proximal region of the Ii luminal domain is structurally disordered, the C-terminal segment of the luminal domain is largely alpha-helical and contains a major interaction site for the Ii trimer []. More information about these proteins can be found at Protein of the Month: MHC [].; GO: 0042289 MHC class II protein binding, 0006886 intracellular protein transport, 0006955 immune response, 0019882 antigen processing and presentation, 0016020 membrane; PDB: 1A6A_C 3QXD_F 3QXA_F 3PDO_C 1MUJ_C 3PGD_F 3PGC_F.
Probab=23.13 E-value=27 Score=25.42 Aligned_cols=29 Identities=17% Similarity=0.137 Sum_probs=0.0
Q ss_pred eeeEEEehhHHHHHHHHHHHHhhheeeeEEE
Q 040325 104 ITALVMGLCLGGGFLVGGVVLIIWLAGIGRK 134 (152)
Q Consensus 104 ~~~l~vgl~v~~~~ll~~~~~~~~~~~~~rr 134 (152)
+...+.|+++-+++++++- ++.+| +++..
T Consensus 30 ra~~vagltvLa~LLiAGQ-a~TaY-fv~~Q 58 (114)
T PF09307_consen 30 RALKVAGLTVLACLLIAGQ-AVTAY-FVFQQ 58 (114)
T ss_dssp -------------------------------
T ss_pred chhHHHHHHHHHHHHHHhH-HHHHH-HHHHh
Confidence 3445667777666666555 55555 55543
No 85
>KOG2952 consensus Cell cycle control protein [Cell cycle control, cell division, chromosome partitioning; Transcription; Signal transduction mechanisms]
Probab=23.11 E-value=67 Score=27.79 Aligned_cols=30 Identities=20% Similarity=0.360 Sum_probs=13.3
Q ss_pred EEEe-hhHHHHHHHHHHHHhhheeeeEEEeccC
Q 040325 107 LVMG-LCLGGGFLVGGVVLIIWLAGIGRKRKDG 138 (152)
Q Consensus 107 l~vg-l~v~~~~ll~~~~~~~~~~~~~rr~~~~ 138 (152)
|.|+ +.+|+.++++++ ++.++ .+.+.|+.+
T Consensus 311 LgI~YLvVG~ic~~l~~-~f~~~-~l~~~r~~~ 341 (351)
T KOG2952|consen 311 LGIAYLVVGSICILLGL-IFLVI-YLFKPRRLG 341 (351)
T ss_pred ceehHHHHHHHHHHHHH-HHHHH-HhhcccccC
Confidence 4444 444554444444 44433 344444444
No 86
>PRK13183 psbN photosystem II reaction center protein N; Provisional
Probab=22.78 E-value=1.4e+02 Score=18.28 Aligned_cols=9 Identities=11% Similarity=0.106 Sum_probs=3.9
Q ss_pred CcCCCCCCC
Q 040325 142 DNQGFSEYI 150 (152)
Q Consensus 142 ~~~~~~~~~ 150 (152)
-.|-||+.+
T Consensus 37 LrDPFeeHe 45 (46)
T PRK13183 37 LDDPFDDHE 45 (46)
T ss_pred cCCchhhcC
Confidence 334444443
No 87
>smart00736 CADG Dystroglycan-type cadherin-like domains. Cadherin-homologous domains present in metazoan dystroglycans and alpha/epsilon sarcoglycans, yeast Axl2p and in a very large protein from magnetotactic bacteria. Likely to bind calcium ions.
Probab=21.35 E-value=82 Score=21.31 Aligned_cols=13 Identities=31% Similarity=0.728 Sum_probs=6.2
Q ss_pred EEEEEEeeCCCCe
Q 040325 14 NEAWISYNSSTHN 26 (152)
Q Consensus 14 ~~awI~Yd~~~~~ 26 (152)
.-.|+.||+.+..
T Consensus 44 lP~Wl~fd~~~~~ 56 (97)
T smart00736 44 LPSWLSFDSDTGT 56 (97)
T ss_pred CCCeEEEeCCCCE
Confidence 3445555554433
No 88
>PF06129 Chordopox_G3: Chordopoxvirus G3 protein; InterPro: IPR010367 This family consists of several poxvirus specific G3 proteins. The function of this family is unknown.
Probab=21.28 E-value=1.1e+02 Score=22.11 Aligned_cols=18 Identities=22% Similarity=0.530 Sum_probs=13.8
Q ss_pred EEEEEEeeCCCCeEEEEE
Q 040325 14 NEAWISYNSSTHNLSVAF 31 (152)
Q Consensus 14 ~~awI~Yd~~~~~L~V~l 31 (152)
-++|+.||+.++...|..
T Consensus 66 ~~v~l~Yds~~~~Vtv~~ 83 (109)
T PF06129_consen 66 SQVILYYDSRSGTVTVAY 83 (109)
T ss_pred cceEEEEccCCCeEEEEE
Confidence 468999999998855544
No 89
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length. Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane. Additionally, their C2A domains are both Ca2+ independent, unlike the case in Slp3 and Slp4/granuphilin in which their C2A domains are Ca2+ dependent. It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain. In addition to Slps, rabphilin, Noc2, and Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp3 and Slp4/granuphilin promote dense-core vesicle exocytosis. Slp5 mRNA has been shown to be restricted to human placenta and liver suggesting a role in Rab27A-dependent membrane trafficking in specific tissues. C2 domains fold into
Probab=21.05 E-value=1.7e+02 Score=19.99 Aligned_cols=21 Identities=33% Similarity=0.281 Sum_probs=18.2
Q ss_pred EEEEEEeeCCCCeEEEEEEcC
Q 040325 14 NEAWISYNSSTHNLSVAFSGL 34 (152)
Q Consensus 14 ~~awI~Yd~~~~~L~V~l~~~ 34 (152)
++..+.||.....|.|++-..
T Consensus 3 i~~~l~y~~~~~~L~V~v~~a 23 (123)
T cd08521 3 IEFSLSYNYKTGSLEVHIKEC 23 (123)
T ss_pred EEEEEEEeCCCCEEEEEEEEe
Confidence 678899999999999999733
No 90
>PF15176 LRR19-TM: Leucine-rich repeat family 19 TM domain
Probab=20.36 E-value=82 Score=22.52 Aligned_cols=9 Identities=11% Similarity=0.556 Sum_probs=4.3
Q ss_pred EEEehhHHH
Q 040325 107 LVMGLCLGG 115 (152)
Q Consensus 107 l~vgl~v~~ 115 (152)
+.+|+.+++
T Consensus 19 ~LVGVv~~a 27 (102)
T PF15176_consen 19 FLVGVVVTA 27 (102)
T ss_pred hHHHHHHHH
Confidence 445555443
No 91
>KOG4818 consensus Lysosomal-associated membrane protein [General function prediction only]
Probab=20.32 E-value=96 Score=26.98 Aligned_cols=12 Identities=42% Similarity=0.650 Sum_probs=5.6
Q ss_pred HhhheeeeEEEec
Q 040325 124 LIIWLAGIGRKRK 136 (152)
Q Consensus 124 ~~~~~~~~~rr~~ 136 (152)
+++++ ++.|||+
T Consensus 344 vliay-lIgrr~~ 355 (362)
T KOG4818|consen 344 VLIAY-LIGRRRS 355 (362)
T ss_pred HHHHh-heeheec
Confidence 44455 5544433
No 92
>cd08680 C2_Kibra C2 domain found in Human protein Kibra. Kibra is thought to be a regulator of the Salvador (Sav)/Warts (Wts)/Hippo (Hpo) (SWH) signaling network, which limits tissue growth by inhibiting cell proliferation and promoting apoptosis. The core of the pathway consists of a MST and LATS family kinase cascade that ultimately phosphorylates and inactivates the YAP/Yorkie (Yki) transcription coactivator. The FERM domain proteins Merlin (Mer) and Expanded (Ex) are part of the upstream regulation controlling pathway mechanism. Kibra colocalizes and associates with Mer and Ex and is thought to transduce an extracellular signal via the SWH network. The apical scaffold machinery that contains Hpo, Wts, and Ex recruits Yki to the apical membrane facilitating its inhibitory phosphorlyation by Wts. Since Kibra associates with Ex and is apically located it is hypothesized that KIBRA is part of the scaffold, helps in the Hpo/Wts complex, and helps recruit Yki for inactivation that prom
Probab=20.20 E-value=1.6e+02 Score=21.02 Aligned_cols=22 Identities=18% Similarity=0.344 Sum_probs=18.8
Q ss_pred eEEEEEEeeCCCCeEEEEEEcC
Q 040325 13 RNEAWISYNSSTHNLSVAFSGL 34 (152)
Q Consensus 13 ~~~awI~Yd~~~~~L~V~l~~~ 34 (152)
.++..+.||....+|.|++-..
T Consensus 2 ~i~~sL~Y~~~~~~L~V~V~~a 23 (124)
T cd08680 2 QVQIGLRYDSGDSSLVISVEQL 23 (124)
T ss_pred eEEEEEEECCCCCEEEEEEeEe
Confidence 3678899999999999999743
Done!