Query         040345
Match_columns 61
No_of_seqs    90 out of 107
Neff          4.2 
Searched_HMMs 46136
Date          Fri Mar 29 07:33:33 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/040345.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/040345hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11779 DUF3317:  Protein of u 100.0 4.2E-30 9.2E-35  149.3   6.2   57    2-58      1-57  (58)
  2 PF10582 Connexin_CCC:  Gap jun  64.4      11 0.00024   22.4   3.1   23   20-42     34-56  (67)
  3 PRK08382 putative monovalent c  54.1      13 0.00028   26.1   2.4   24   23-46     29-52  (201)
  4 KOG3927 Na+/K+ ATPase, beta su  51.8      18 0.00039   27.0   3.0   52    5-56     20-75  (300)
  5 PF06955 XET_C:  Xyloglucan end  46.9     2.7 5.9E-05   23.3  -1.5   14    2-15     22-35  (51)
  6 PF08546 ApbA_C:  Ketopantoate   43.9      33 0.00072   20.7   2.9   19   24-42      5-23  (125)
  7 PF14654 Epiglycanin_C:  Mucin,  40.6      56  0.0012   21.3   3.7   10   23-32     15-24  (106)
  8 PHA02078 hypothetical protein   38.2      27 0.00058   20.4   1.7   11   25-35     32-42  (54)
  9 PHA02902 putative IMV membrane  38.0      62  0.0013   19.7   3.3   22   28-49      5-26  (70)
 10 KOG4841 Dolichol-phosphate man  37.4      78  0.0017   20.3   3.9   36   13-48     23-59  (95)
 11 PF10183 ESSS:  ESSS subunit of  34.3      40 0.00087   21.0   2.2   28   24-53     57-84  (105)
 12 PRK07597 secE preprotein trans  33.8      91   0.002   17.5   4.5   34   25-58     27-60  (64)
 13 PHA02291 hypothetical protein   31.5      60  0.0013   21.8   2.8   20   27-46      4-23  (132)
 14 PF12113 SVM_signal:  SVM prote  31.3      36 0.00078   18.0   1.4   17   29-45      9-25  (33)
 15 PF06682 DUF1183:  Protein of u  29.5      61  0.0013   24.4   2.8   22   28-49    157-178 (318)
 16 PF09889 DUF2116:  Uncharacteri  27.5 1.1E+02  0.0025   17.7   3.2   18   29-46     40-57  (59)
 17 PF11710 Git3:  G protein-coupl  27.4   2E+02  0.0044   19.5   4.9   36   25-60    165-200 (201)
 18 PRK10179 formate dehydrogenase  26.1 1.5E+02  0.0032   20.4   4.0   29   23-51    109-137 (217)
 19 PF04418 DUF543:  Domain of unk  25.2 1.4E+02  0.0031   17.9   3.4   20   24-43     20-39  (75)
 20 PF07074 TRAP-gamma:  Transloco  24.3 2.3E+02  0.0049   19.8   4.7   40    6-58     34-73  (170)
 21 PF04835 Pox_A9:  A9 protein co  23.3 1.3E+02  0.0028   17.5   2.8   17   28-44     28-44  (54)
 22 PHA02681 ORF089 virion membran  22.8      92   0.002   19.9   2.3   16   33-48     10-25  (92)
 23 TIGR00964 secE_bact preprotein  22.6 1.5E+02  0.0032   16.2   4.5   34   25-58     18-51  (55)
 24 PF12129 Phtf-FEM1B_bdg:  Male   22.5 1.2E+02  0.0025   21.1   3.0   23    3-32      6-28  (159)
 25 PRK08476 F0F1 ATP synthase sub  21.8   2E+02  0.0043   18.4   3.8   23   28-51      9-31  (141)
 26 PRK14487 cbb3-type cytochrome   20.3 1.8E+02  0.0039   21.0   3.7   33   23-55      2-34  (217)

No 1  
>PF11779 DUF3317:  Protein of unknown function (DUF3317);  InterPro: IPR024512 Serine palmitoyltransferase (SPT) catalyzes the first committed step in sphingolipid biosynthesis. In mammals, two small subunits of serine palmitoyltransferase, ssSPTa and ssSPTb, substantially enhance the activity of SPT, conferring full enzyme activity upon it []. The 2 ssSPT isoforms share a conserved hydrophobic central domain, which is predicted to reside in the membrane.  This entry represents the small subunits of serine palmitoyltransferase. It also includes a number of putative uncharacterised proteins from fungi and plants.
Probab=99.96  E-value=4.2e-30  Score=149.29  Aligned_cols=57  Identities=40%  Similarity=0.826  Sum_probs=54.8

Q ss_pred             hhhHHHHHHHHHHHHHhhhhccchHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHhhh
Q 040345            2 RAMNWIQRKIHLYNVTFGLYMLDWWERYLFNILVVVLMWFIFYNGSKYVTDFFQRHL   58 (61)
Q Consensus         2 ~~~~w~~~k~yqYeVT~glYML~pwEk~iFns~v~~ll~l~~~~~~~YlP~~~~~~~   58 (61)
                      |.+||++||+||||||||+||||||||++||++++++++++++|+++|+|+|++...
T Consensus         1 ~~~~~l~~~~~~Yevt~~lyMlepwEk~~fn~~~~~l~~l~~~~~~~ylP~h~~~~~   57 (58)
T PF11779_consen    1 GFMNWLSRKYYQYEVTFGLYMLEPWEKFLFNSFLLLLLSLILYATYLYLPSHIRFII   57 (58)
T ss_pred             CHHHHHHHHHHHHhheeeeeeccHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHh
Confidence            679999999999999999999999999999999999999999999999999998753


No 2  
>PF10582 Connexin_CCC:  Gap junction channel protein cysteine-rich domain;  InterPro: IPR019570 The connexins are a family of integral membrane proteins that oligomerise to form intercellular channels that are clustered at gap junctions. These channels are specialised sites of cell-cell contact that allow the passage of ions, intracellular metabolites and messenger molecules (with molecular weight less than 1-2kDa) from the cytoplasm of one cell to its opposing neighbours. They are found in almost all vertebrate cell types, and somewhat similar proteins have been cloned from plant species. Invertebrates utilise a different family of molecules, innexins, that share a similar predicted secondary structure to the vertebrate connexins, but have no sequence identity to them []. Vertebrate gap junction channels are thought to participate in diverse biological functions. For instance, in the heart they permit the rapid cell-cell transfer of action potentials, ensuring coordinated contraction of the cardiomyocytes. They are also responsible for neurotransmission at specialised 'electrical' synapses. In non-excitable tissues, such as the liver, they may allow metabolic cooperation between cells. In the brain, glial cells are extensively-coupled by gap junctions; this allows waves of intracellular Ca2+ to propagate through nervous tissue, and may contribute to their ability to spatially-buffer local changes in extracellular K+ concentration []. The connexin protein family is encoded by at least 13 genes in rodents, with many homologues cloned from other species. They show overlapping tissue expression patterns, most tissues expressing more than one connexin type. Their conductances, permeability to different molecules, phosphorylation and voltage-dependence of their gating, have been found to vary. Possible communication diversity is increased further by the fact that gap junctions may be formed by the association of different connexin isoforms from apposing cells. However, in vitro studies have shown that not all possible combinations of connexins produce active channels [, ]. Hydropathy analysis predicts that all cloned connexins share a common transmembrane (TM) topology. Each connexin is thought to contain 4 TM domains, with two extracellular and three cytoplasmic regions. This model has been validated for several of the family members by in vitro biochemical analysis. Both N- and C-termini are thought to face the cytoplasm, and the third TM domain has an amphipathic character, suggesting that it contributes to the lining of the formed-channel. Amino acid sequence identity between the isoforms is ~50-80%, with the TM domains being well conserved. Both extracellular loops contain characteristically conserved cysteine residues, which likely form intramolecular disulphide bonds. By contrast, the single putative intracellular loop (between TM domains 2 and 3) and the cytoplasmic C terminus are highly variable among the family members. Six connexins are thought to associate to form a hemi-channel, or connexon. Two connexons then interact (likely via the extracellular loops of their connexins) to form the complete gap junction channel.  NH2-*** *** *************-COOH ** ** ** ** ** ** ** ** Cytoplasmic ---**----**-----**----**---------------- ** ** ** ** Membrane ** ** ** ** ---**----**-----**----**---------------- ** ** ** ** Extracellular ** ** ** ** ** **  Two sets of nomenclature have been used to identify the connexins. The first, and most commonly used, classifies the connexin molecules according to molecular weight, such as connexin43 (abbreviated to Cx43), indicating a connexin of molecular weight close to 43kDa. However, studies have revealed cases where clear functional homologues exist across species that have quite different molecular masses; therefore, an alternative nomenclature was proposed based on evolutionary considerations, which divides the family into two major subclasses, alpha and beta, each with a number of members []. Due to their ubiquity and overlapping tissue distributions, it has proved difficult to elucidate the functions of individual connexin isoforms. To circumvent this problem, particular connexin-encoding genes have been subjected to targeted-disruption in mice, and the phenotype of the resulting animals investigated. Around half the connexin isoforms have been investigated in this manner []. Further insight into the functional roles of connexins has come from the discovery that a number of human diseases are caused by mutations in connexin genes. For instance, mutations in Cx32 give rise to a form of inherited peripheral neuropathy called X-linked dominant Charcot-Marie-Tooth disease []. Similarly, mutations in Cx26 are responsible for both autosomal recessive and dominant forms of nonsyndromic deafness, a disorder characterised by hearing loss, with no apparent effects on other organ systems. This entry represents the cysteine rich domain of the connexins.; PDB: 2ZW3_F.
Probab=64.38  E-value=11  Score=22.40  Aligned_cols=23  Identities=13%  Similarity=0.161  Sum_probs=16.4

Q ss_pred             hhccchHHHHHHHHHHHHHHHHH
Q 040345           20 LYMLDWWERYLFNILVVVLMWFI   42 (61)
Q Consensus        20 lYML~pwEk~iFns~v~~ll~l~   42 (61)
                      .|+=.|+||.+|-.+.+.+-+..
T Consensus        34 CfVSRPtEKtIfl~fM~~~s~vs   56 (67)
T PF10582_consen   34 CFVSRPTEKTIFLIFMFAVSCVS   56 (67)
T ss_dssp             EE-SSHHHHHHHHHHHHHHHHHH
T ss_pred             EeCCCCchhhhHHHHHHHHHHHH
Confidence            35567999999988877765543


No 3  
>PRK08382 putative monovalent cation/H+ antiporter subunit E; Reviewed
Probab=54.08  E-value=13  Score=26.10  Aligned_cols=24  Identities=29%  Similarity=0.797  Sum_probs=19.7

Q ss_pred             cchHHHHHHHHHHHHHHHHHHHHh
Q 040345           23 LDWWERYLFNILVVVLMWFIFYNG   46 (61)
Q Consensus        23 L~pwEk~iFns~v~~ll~l~~~~~   46 (61)
                      +.|||++++-++++.++|++.-+.
T Consensus        29 ~~~~~~~~~~~llLf~~WllLsg~   52 (201)
T PRK08382         29 LPPWERFVLTWLILLAFWVIISGD   52 (201)
T ss_pred             CCcchHHHHHHHHHHHHHHHHhCC
Confidence            568999999999999999876553


No 4  
>KOG3927 consensus Na+/K+ ATPase, beta subunit [Inorganic ion transport and metabolism]
Probab=51.81  E-value=18  Score=27.04  Aligned_cols=52  Identities=19%  Similarity=0.272  Sum_probs=39.2

Q ss_pred             HHHHHHHHHHHHHhhhhc----cchHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHh
Q 040345            5 NWIQRKIHLYNVTFGLYM----LDWWERYLFNILVVVLMWFIFYNGSKYVTDFFQR   56 (61)
Q Consensus         5 ~w~~~k~yqYeVT~glYM----L~pwEk~iFns~v~~ll~l~~~~~~~YlP~~~~~   56 (61)
                      ++-.+|.++||-..|-+|    -+|++-.+|++++..+++.++......+=+++.+
T Consensus        20 ~~~~~~~~~~n~~~~~~~GRT~~sW~~IllfYivFY~~la~lf~~~~~~~~~tidp   75 (300)
T KOG3927|consen   20 KPEEWKEFLYNPETGTFLGRTGSSWAKILLFYIVFYGVLAALFAGCMWFMLQTIDP   75 (300)
T ss_pred             cchhhHHheeCcccCeEECcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCC
Confidence            466778899998887776    4577777999999999988877766555555443


No 5  
>PF06955 XET_C:  Xyloglucan endo-transglycosylase (XET) C-terminus;  InterPro: IPR010713 This entry represents the C terminus (approximately 60 residues) of plant xyloglucan endo-transglycosylase (XET). Xyloglucan is the predominant hemicellulose in the cell walls of most dicotyledons. With cellulose, it forms a network that strengthens the cell wall. XET catalyses the splitting of xyloglucan chains and the linking of the newly generated reducing end to the non-reducing end of another xyloglucan chain, thereby loosening the cell wall []. ; GO: 0016762 xyloglucan:xyloglucosyl transferase activity, 0006073 cellular glucan metabolic process, 0005618 cell wall, 0048046 apoplast; PDB: 1UMZ_A 1UN1_B 2VH9_B 2UWC_A 2UWB_B 2UWA_C.
Probab=46.88  E-value=2.7  Score=23.33  Aligned_cols=14  Identities=36%  Similarity=1.051  Sum_probs=10.8

Q ss_pred             hhhHHHHHHHHHHH
Q 040345            2 RAMNWIQRKIHLYN   15 (61)
Q Consensus         2 ~~~~w~~~k~yqYe   15 (61)
                      ++|+|+++++.-|+
T Consensus        22 ~~m~wvr~~ymiYd   35 (51)
T PF06955_consen   22 RQMRWVRRNYMIYD   35 (51)
T ss_dssp             HHHHHHHHHCEEEE
T ss_pred             HHHHHHHHcCeEec
Confidence            57999999986553


No 6  
>PF08546 ApbA_C:  Ketopantoate reductase PanE/ApbA C terminal;  InterPro: IPR013752 This is the C-terminal domain of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, 1.1.1.169 from EC. The reaction catalysed by this enzyme is: (R)-pantoate + NADP(+) = 2-dehydropantoate + NADPH. AbpA catalyses the NADPH reduction of ketopantoic acid to pantoic acid in the alternative pyrimidine biosynthetic (APB) pathway []. ApbA and PanE are allelic []. ApbA, the ketopantoate reductase enzyme is required for the synthesis of thiamine via the APB biosynthetic pathway []. ; GO: 0016491 oxidoreductase activity, 0050661 NADP binding, 0055114 oxidation-reduction process; PDB: 1YJQ_A 1KS9_A 2OFP_A 1YON_A 2EW2_B 3EGO_B 3HN2_D 3GHY_B 3G17_E 3HWR_B ....
Probab=43.89  E-value=33  Score=20.66  Aligned_cols=19  Identities=26%  Similarity=0.588  Sum_probs=15.0

Q ss_pred             chHHHHHHHHHHHHHHHHH
Q 040345           24 DWWERYLFNILVVVLMWFI   42 (61)
Q Consensus        24 ~pwEk~iFns~v~~ll~l~   42 (61)
                      +-|+|.++|+.+=.+.++.
T Consensus         5 ~~w~Kl~~n~~~n~l~al~   23 (125)
T PF08546_consen    5 ERWEKLIFNAAINPLTALT   23 (125)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4699999998777766664


No 7  
>PF14654 Epiglycanin_C:  Mucin, catalytic, TM and cytoplasmic tail region
Probab=40.62  E-value=56  Score=21.34  Aligned_cols=10  Identities=40%  Similarity=0.850  Sum_probs=7.8

Q ss_pred             cchHHHHHHH
Q 040345           23 LDWWERYLFN   32 (61)
Q Consensus        23 L~pwEk~iFn   32 (61)
                      |.|||-+++-
T Consensus        15 L~PWeIfLIt   24 (106)
T PF14654_consen   15 LKPWEIFLIT   24 (106)
T ss_pred             ccchHHHHHH
Confidence            6899987664


No 8  
>PHA02078 hypothetical protein
Probab=38.19  E-value=27  Score=20.39  Aligned_cols=11  Identities=36%  Similarity=0.830  Sum_probs=9.2

Q ss_pred             hHHHHHHHHHH
Q 040345           25 WWERYLFNILV   35 (61)
Q Consensus        25 pwEk~iFns~v   35 (61)
                      ||||.|.-+++
T Consensus        32 P~ER~Iylsll   42 (54)
T PHA02078         32 PWEREIYAALL   42 (54)
T ss_pred             HHHHHHHHHHH
Confidence            99999887765


No 9  
>PHA02902 putative IMV membrane protein; Provisional
Probab=37.96  E-value=62  Score=19.72  Aligned_cols=22  Identities=14%  Similarity=0.485  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhh
Q 040345           28 RYLFNILVVVLMWFIFYNGSKY   49 (61)
Q Consensus        28 k~iFns~v~~ll~l~~~~~~~Y   49 (61)
                      -++.-.+..+++++++|++|+=
T Consensus         5 tfvi~~v~v~Ivclliya~YrR   26 (70)
T PHA02902          5 TFVILAVIVIIFCLLIYAAYKR   26 (70)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHH
Confidence            3555666777888899998863


No 10 
>KOG4841 consensus Dolichol-phosphate mannosyltransferase, subunit 3 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]
Probab=37.38  E-value=78  Score=20.31  Aligned_cols=36  Identities=19%  Similarity=0.016  Sum_probs=28.4

Q ss_pred             HHHHHhhhhccc-hHHHHHHHHHHHHHHHHHHHHhhh
Q 040345           13 LYNVTFGLYMLD-WWERYLFNILVVVLMWFIFYNGSK   48 (61)
Q Consensus        13 qYeVT~glYML~-pwEk~iFns~v~~ll~l~~~~~~~   48 (61)
                      .+.||+++.=|+ ||.-..-+.=.+.++++-||+...
T Consensus        23 ~~~vt~~l~~Leeplscl~~y~P~~~~l~~G~Ya~~t   59 (95)
T KOG4841|consen   23 WVAVTTGLLGLEEPLSCLEVYWPLYLLLSAGCYALGT   59 (95)
T ss_pred             HHHHHHHHccCcccHHHHHhhhHHHHHHHHHhHhhhh
Confidence            578887766665 998888888889999998888653


No 11 
>PF10183 ESSS:  ESSS subunit of NADH:ubiquinone oxidoreductase (complex I) ;  InterPro: IPR019329  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I [].  This entry represents the ESSS subunit from mitochondrial NADH:ubiquinone oxidoreductase (complex I). It carries mitochondrial import sequences []. 
Probab=34.27  E-value=40  Score=21.03  Aligned_cols=28  Identities=21%  Similarity=0.120  Sum_probs=18.3

Q ss_pred             chHHHHHHHHHHHHHHHHHHHHhhhhhHHH
Q 040345           24 DWWERYLFNILVVVLMWFIFYNGSKYVTDF   53 (61)
Q Consensus        24 ~pwEk~iFns~v~~ll~l~~~~~~~YlP~~   53 (61)
                      +-||...|-++.+.++.+.+  .+.|.||+
T Consensus        57 e~we~~~f~~~~~~~v~~~~--~~~y~PD~   84 (105)
T PF10183_consen   57 EGWELPFFFGFSGSLVFGGV--FLAYKPDT   84 (105)
T ss_pred             hhhHHHHHHHHHHHHHHHHH--HHHcCCCC
Confidence            46888888777666665544  34566775


No 12 
>PRK07597 secE preprotein translocase subunit SecE; Reviewed
Probab=33.77  E-value=91  Score=17.48  Aligned_cols=34  Identities=24%  Similarity=0.325  Sum_probs=27.9

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHhhh
Q 040345           25 WWERYLFNILVVVLMWFIFYNGSKYVTDFFQRHL   58 (61)
Q Consensus        25 pwEk~iFns~v~~ll~l~~~~~~~YlP~~~~~~~   58 (61)
                      |.-|.++++.+.++...++.+.+.++=|.+-..+
T Consensus        27 Ps~~e~~~~t~~Vi~~~~~~~~~i~~vD~~~~~~   60 (64)
T PRK07597         27 PTRKELVRSTIVVLVFVAFFALFFYLVDLLFSKL   60 (64)
T ss_pred             cCHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            6677888888888888899999999988776554


No 13 
>PHA02291 hypothetical protein
Probab=31.47  E-value=60  Score=21.76  Aligned_cols=20  Identities=30%  Similarity=0.454  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHh
Q 040345           27 ERYLFNILVVVLMWFIFYNG   46 (61)
Q Consensus        27 Ek~iFns~v~~ll~l~~~~~   46 (61)
                      .+.+|+.+++++++..+++-
T Consensus         4 K~~iFYiL~~~VL~~si~sY   23 (132)
T PHA02291          4 KASIFYILVVIVLAFSISSY   23 (132)
T ss_pred             chhhHHHHHHHHHHHHHHHH
Confidence            36789999999988877653


No 14 
>PF12113 SVM_signal:  SVM protein signal sequence;  InterPro: IPR021970  This domain is presumed to be a signal peptide sequence found in Sequence-variable mosaic (SVM) proteins []. It is found in phytoplasmas. This presumed signal sequence is about 30 amino acids in length. 
Probab=31.32  E-value=36  Score=18.02  Aligned_cols=17  Identities=18%  Similarity=0.532  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 040345           29 YLFNILVVVLMWFIFYN   45 (61)
Q Consensus        29 ~iFns~v~~ll~l~~~~   45 (61)
                      .++|.++|+++++.+++
T Consensus         9 ~ii~i~Lf~~LGL~fI~   25 (33)
T PF12113_consen    9 KIINIFLFIFLGLFFIT   25 (33)
T ss_pred             hhhhhHHHHHHHHHhee
Confidence            46788999999988764


No 15 
>PF06682 DUF1183:  Protein of unknown function (DUF1183);  InterPro: IPR009567 This family consists of several eukaryotic proteins of around 360 residues in length. The function of this family is unknown.
Probab=29.50  E-value=61  Score=24.37  Aligned_cols=22  Identities=27%  Similarity=0.476  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhh
Q 040345           28 RYLFNILVVVLMWFIFYNGSKY   49 (61)
Q Consensus        28 k~iFns~v~~ll~l~~~~~~~Y   49 (61)
                      -.+|..++++++++++|.+++-
T Consensus       157 ~~lf~ii~l~vla~ivY~~~~~  178 (318)
T PF06682_consen  157 SWLFWIIFLLVLAFIVYSLFLS  178 (318)
T ss_pred             chhhhHHHHHHHHHHHHHHHhc
Confidence            3678889999999999988764


No 16 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=27.55  E-value=1.1e+02  Score=17.66  Aligned_cols=18  Identities=11%  Similarity=0.373  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 040345           29 YLFNILVVVLMWFIFYNG   46 (61)
Q Consensus        29 ~iFns~v~~ll~l~~~~~   46 (61)
                      .++..++++++++.++..
T Consensus        40 ~i~~~~~i~~l~v~~~~~   57 (59)
T PF09889_consen   40 YIFFGIFILFLAVWIFMT   57 (59)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            455555665555555443


No 17 
>PF11710 Git3:  G protein-coupled glucose receptor regulating Gpa2;  InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor. Git3 is one of six proteins required for glucose-triggered adenylate cyclase activation, and is a G protein-coupled receptor responsible for the activation of adenylate cyclase through Gpa2 - heterotrimeric G protein alpha subunit, part of the glucose-detection pathway. Git3 contains seven predicted transmembrane domains, a third cytoplasmic loop and a cytoplasmic tail []. This is the conserved N-terminal domain of the member proteins. 
Probab=27.39  E-value=2e+02  Score=19.48  Aligned_cols=36  Identities=11%  Similarity=0.181  Sum_probs=27.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHhhhhc
Q 040345           25 WWERYLFNILVVVLMWFIFYNGSKYVTDFFQRHLTV   60 (61)
Q Consensus        25 pwEk~iFns~v~~ll~l~~~~~~~YlP~~~~~~~~~   60 (61)
                      +|||...+=+-.-+..+.....|..+=-|++|+.+.
T Consensus       165 ~~~Rl~l~y~~~~~~~~~~i~iY~~if~~lrr~~~~  200 (201)
T PF11710_consen  165 EWYRLWLHYIWRFIIIFAIIIIYIAIFFYLRRRIRR  200 (201)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcc
Confidence            578888887776677777777777777788888764


No 18 
>PRK10179 formate dehydrogenase-N subunit gamma; Provisional
Probab=26.06  E-value=1.5e+02  Score=20.39  Aligned_cols=29  Identities=3%  Similarity=0.099  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHHHHHHHHHHHHHhhhhhH
Q 040345           23 LDWWERYLFNILVVVLMWFIFYNGSKYVT   51 (61)
Q Consensus        23 L~pwEk~iFns~v~~ll~l~~~~~~~YlP   51 (61)
                      ..|.||..+-.+.+..+.+++.+...|.|
T Consensus       109 ~N~~QKl~y~~i~~~~~~~i~TGl~l~~~  137 (217)
T PRK10179        109 YNAGQKMMFWSIMSMIFVLLVTGVIIWRP  137 (217)
T ss_pred             cCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            56889998888877777777666666655


No 19 
>PF04418 DUF543:  Domain of unknown function (DUF543);  InterPro: IPR007512 This family of short eukaryotic proteins has no known function. Most of the members of this family are only 80 amino acid residues long. However the Arabidopsis homologue is over 300 residues long. These proteins contain a conserved N-terminal cysteine and a conserved motif GXGXGXG in the carboxy terminal half that may be functionally important.
Probab=25.20  E-value=1.4e+02  Score=17.92  Aligned_cols=20  Identities=30%  Similarity=0.446  Sum_probs=16.2

Q ss_pred             chHHHHHHHHHHHHHHHHHH
Q 040345           24 DWWERYLFNILVVVLMWFIF   43 (61)
Q Consensus        24 ~pwEk~iFns~v~~ll~l~~   43 (61)
                      +-|+||+-|+++=...++.+
T Consensus        20 ~kwD~cl~~~l~k~~~G~~~   39 (75)
T PF04418_consen   20 EKWDRCLSDTLVKTGLGFGI   39 (75)
T ss_pred             HHHHHHHHHHHHHHhhhhhH
Confidence            46999999999977777654


No 20 
>PF07074 TRAP-gamma:  Translocon-associated protein, gamma subunit (TRAP-gamma);  InterPro: IPR009779 This family consists of several eukaryotic translocon-associated protein, gamma subunit (TRAP-gamma) sequences. The translocation site (translocon), at which nascent polypeptides pass through the endoplasmic reticulum membrane, contains a component previously called 'signal sequence receptor' that is now renamed as 'translocon-associated protein' (TRAP). The TRAP complex is comprised of four membrane proteins alpha, beta, gamma and delta, which are present in a stoichiometric relation, and are genuine neighbours in intact microsomes. The gamma subunit is predicted to span the membrane four times [].; GO: 0006613 cotranslational protein targeting to membrane, 0005784 Sec61 translocon complex, 0030176 integral to endoplasmic reticulum membrane
Probab=24.28  E-value=2.3e+02  Score=19.83  Aligned_cols=40  Identities=15%  Similarity=0.299  Sum_probs=20.9

Q ss_pred             HHHHHHHHHHHHhhhhccchHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHhhh
Q 040345            6 WIQRKIHLYNVTFGLYMLDWWERYLFNILVVVLMWFIFYNGSKYVTDFFQRHL   58 (61)
Q Consensus         6 w~~~k~yqYeVT~glYML~pwEk~iFns~v~~ll~l~~~~~~~YlP~~~~~~~   58 (61)
                      |+.+.++|.++.         +    |.+++++.+.+....-.+.-+-+++.|
T Consensus        34 ~LF~~Ih~m~~~---------~----~~I~f~i~t~~sayll~fAYkNvk~~l   73 (170)
T PF07074_consen   34 WLFWRIHQMDLY---------D----SLIVFVIVTLVSAYLLAFAYKNVKFVL   73 (170)
T ss_pred             HHHHHHHhcccc---------h----hhHHHHHHHHHHHHHHHHHHHhHHHHH
Confidence            666666665554         3    445555555555444444444444433


No 21 
>PF04835 Pox_A9:  A9 protein conserved region;  InterPro: IPR006920 This entry represents a family of Chordopoxvirus A9 proteins. Chordopoxvirus belongs to the family Poxviridae and is the cause of vertebrate infections [].
Probab=23.33  E-value=1.3e+02  Score=17.55  Aligned_cols=17  Identities=0%  Similarity=0.299  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 040345           28 RYLFNILVVVLMWFIFY   44 (61)
Q Consensus        28 k~iFns~v~~ll~l~~~   44 (61)
                      |.+++.+++++++...+
T Consensus        28 k~vismimylilGi~L~   44 (54)
T PF04835_consen   28 KSVISMIMYLILGIALI   44 (54)
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            77888888888888763


No 22 
>PHA02681 ORF089 virion membrane protein; Provisional
Probab=22.84  E-value=92  Score=19.87  Aligned_cols=16  Identities=13%  Similarity=0.384  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHhhh
Q 040345           33 ILVVVLMWFIFYNGSK   48 (61)
Q Consensus        33 s~v~~ll~l~~~~~~~   48 (61)
                      .++..++++++|+.|+
T Consensus        10 ~V~V~IVclliya~YR   25 (92)
T PHA02681         10 VIVISIVCYIVIMMYR   25 (92)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5677788899999886


No 23 
>TIGR00964 secE_bact preprotein translocase, SecE subunit, bacterial. This model represents exclusively the bacterial (and some organellar) SecE protein. SecE is part of the core heterotrimer, SecYEG, of the Sec preprotein translocase system. Other components are the ATPase SecA, a cytosolic chaperone SecB, and an accessory complex of SecDF and YajC.
Probab=22.64  E-value=1.5e+02  Score=16.23  Aligned_cols=34  Identities=21%  Similarity=0.335  Sum_probs=26.8

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHhhh
Q 040345           25 WWERYLFNILVVVLMWFIFYNGSKYVTDFFQRHL   58 (61)
Q Consensus        25 pwEk~iFns~v~~ll~l~~~~~~~YlP~~~~~~~   58 (61)
                      |--|.++++.+.++...++.+.+.++-|.+-+.+
T Consensus        18 Pt~~e~~~~t~~Vi~~~~~~~~~~~~~D~~~~~~   51 (55)
T TIGR00964        18 PSRKELITYTIVVIVFVIFFSLFLFGVDYVFGKL   51 (55)
T ss_pred             cCHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5556778888888888889999999888776554


No 24 
>PF12129 Phtf-FEM1B_bdg:  Male germ-cell putative homeodomain transcription factor;  InterPro: IPR021980  This domain is found in bacteria and eukaryotes, and is typically between 101 and 140 amino acids in length. Phtf proteins do not display any sequence similarity to known or predicted proteins, but their conservation among species suggests an essential function. The 84 kDa Phtf1 protein is an integral membrane protein, anchored to a cell membrane by six to eight trans-membrane domains, that is associated with a domain of the endoplasmic reticulum (ER) juxtaposed to the Golgi apparatus. It is present during meiosis and spermiogenesis, and, by the end of spermiogenesis, is released from the mature spermatozoon within the residual bodies []. Phtf1 enhances the binding of FEM1B -feminisation homologue 1B - to cell membranes. Fem-1 was initially identified in the signaling pathway for sex determination, as well as being implicated in apoptosis, but its biochemical role is still unclear, and neither FEM1B nor PHTF1 is directly implicated in apoptosis in spermatogenesis. It is the ANK domain of FEM1B that is necessary for the interaction with the N-terminal region of Phtf1 []. 
Probab=22.47  E-value=1.2e+02  Score=21.06  Aligned_cols=23  Identities=35%  Similarity=0.767  Sum_probs=15.8

Q ss_pred             hhHHHHHHHHHHHHHhhhhccchHHHHHHH
Q 040345            3 AMNWIQRKIHLYNVTFGLYMLDWWERYLFN   32 (61)
Q Consensus         3 ~~~w~~~k~yqYeVT~glYML~pwEk~iFn   32 (61)
                      ...|.|.|+=.|+-       .-|||.+--
T Consensus         6 ~i~wyQkKig~YD~-------q~WEksveq   28 (159)
T PF12129_consen    6 AIAWYQKKIGAYDQ-------QIWEKSVEQ   28 (159)
T ss_pred             HHHHHHHHHhhhHH-------HHHHHHHHH
Confidence            46788888655554       459998754


No 25 
>PRK08476 F0F1 ATP synthase subunit B'; Validated
Probab=21.76  E-value=2e+02  Score=18.43  Aligned_cols=23  Identities=22%  Similarity=0.360  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhhhH
Q 040345           28 RYLFNILVVVLMWFIFYNGSKYVT   51 (61)
Q Consensus        28 k~iFns~v~~ll~l~~~~~~~YlP   51 (61)
                      -+++..+.|+++ +++.+-+.|=|
T Consensus         9 ~~~~qli~Flil-~~~l~kfl~kP   31 (141)
T PRK08476          9 LMLATFVVFLLL-IVILNSWLYKP   31 (141)
T ss_pred             HHHHHHHHHHHH-HHHHHHHHHHH
Confidence            456666666666 44445555655


No 26 
>PRK14487 cbb3-type cytochrome c oxidase subunit II; Provisional
Probab=20.26  E-value=1.8e+02  Score=20.97  Aligned_cols=33  Identities=21%  Similarity=0.110  Sum_probs=24.4

Q ss_pred             cchHHHHHHHHHHHHHHHHHHHHhhhhhHHHHH
Q 040345           23 LDWWERYLFNILVVVLMWFIFYNGSKYVTDFFQ   55 (61)
Q Consensus        23 L~pwEk~iFns~v~~ll~l~~~~~~~YlP~~~~   55 (61)
                      -+++||..+-.++++++++++=....-+|.+.+
T Consensus         2 h~~~e~~~~~~~v~~~~~v~~g~~v~ivp~~~~   34 (217)
T PRK14487          2 HEILEKNPGLLAVLTLLVVSIGGLVEIVPLFFQ   34 (217)
T ss_pred             chhhhhhhHHHHHHHHHHHHHHHHHHhhhhhhh
Confidence            468899888888888877776666666676654


Done!