Query         040351
Match_columns 232
No_of_seqs    111 out of 276
Neff          5.5 
Searched_HMMs 46136
Date          Fri Mar 29 07:36:31 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/040351.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/040351hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 smart00452 STI Soybean trypsin 100.0 1.9E-57 4.1E-62  384.1  20.5  169   30-222     1-172 (172)
  2 cd00178 STI Soybean trypsin in 100.0 1.4E-56   3E-61  378.8  19.6  167   29-220     1-172 (172)
  3 PF00197 Kunitz_legume:  Trypsi 100.0 2.7E-56 5.8E-61  377.9  18.2  169   29-220     1-176 (176)
  4 PF07951 Toxin_R_bind_C:  Clost  76.4     7.5 0.00016   34.4   6.0  120   27-155     7-146 (214)
  5 KOG3858 Ephrin, ligand for Eph  53.5      13 0.00029   33.4   3.0   55   34-90    117-177 (233)
  6 PF02402 Lysis_col:  Lysis prot  45.4      18 0.00039   24.5   2.0   19   24-42     18-36  (46)
  7 PF07172 GRP:  Glycine rich pro  39.6      18  0.0004   27.9   1.5    8    2-9       4-11  (95)
  8 PF14009 DUF4228:  Domain of un  37.1      21 0.00046   28.8   1.6   21   33-53     64-84  (181)
  9 COG5341 Uncharacterized protei  36.0 2.5E+02  0.0054   23.1   8.1   18   93-110   103-120 (132)
 10 PF05474 Semenogelin:  Semenoge  32.3      23 0.00049   35.3   1.2   15    1-15      1-15  (582)
 11 PF08194 DIM:  DIM protein;  In  32.1      62  0.0013   20.9   2.8   16    1-17      1-16  (36)
 12 PF05550 Peptidase_C53:  Pestiv  30.3      35 0.00076   28.8   1.8   25   17-41     11-35  (168)
 13 PF00879 Defensin_propep:  Defe  29.9      54  0.0012   22.9   2.4   18    1-19      1-18  (52)
 14 PF09466 Yqai:  Hypothetical pr  29.7      41 0.00088   24.9   1.9   21   28-48     24-44  (71)
 15 PRK11354 kil FtsZ inhibitor pr  27.9      41 0.00089   25.0   1.7   47   35-87     19-69  (73)
 16 COG4851 CamS Protein involved   27.2      63  0.0014   30.6   3.1   59    1-61      1-71  (382)
 17 PRK10220 hypothetical protein;  26.5      79  0.0017   25.4   3.2   27   28-54     42-68  (111)
 18 TIGR00686 phnA alkylphosphonat  25.7      85  0.0018   25.1   3.2   27   28-54     41-67  (109)
 19 TIGR02052 MerP mercuric transp  24.9      47   0.001   22.8   1.5   14    1-17      1-14  (92)
 20 COG5510 Predicted small secret  23.0      64  0.0014   21.8   1.7   17    1-17      2-18  (44)
 21 COG2824 PhnA Uncharacterized Z  22.8   1E+02  0.0022   24.7   3.2   27   28-54     43-69  (112)
 22 PRK10159 outer membrane phosph  22.6      51  0.0011   30.7   1.7   36    1-42      1-36  (351)
 23 PF00812 Ephrin:  Ephrin;  Inte  22.4      55  0.0012   27.2   1.6   21   34-54    101-121 (145)
 24 PLN03207 stomagen; Provisional  21.9      43 0.00094   26.5   0.9    8    8-15     14-21  (113)
 25 PF03831 PhnA:  PhnA protein;    20.9      52  0.0011   23.3   1.0   21   30-50      2-22  (56)

No 1  
>smart00452 STI Soybean trypsin inhibitor (Kunitz) family of protease inhibitors.
Probab=100.00  E-value=1.9e-57  Score=384.13  Aligned_cols=169  Identities=30%  Similarity=0.556  Sum_probs=152.4

Q ss_pred             eecCCCCcccCCCCEEEEecccCCCCCCceEEecCCCCCCCCceEEcCCCCCCCceEEEecCC-CCcceecccceEEEEe
Q 040351           30 ILDVYGNQVDSSHRYYLVSALWGVKTGGGISADKGKNGQCPTDVIQLSPKDKRGKNLVLLPND-NSIIVRESTNIKLKFS  108 (232)
Q Consensus        30 VlDtdG~~L~~G~~YYIlPa~~g~G~gGGl~l~~t~n~~CPl~VvQ~~~~~~~GlPV~Fsp~~-~~~vI~e~t~lnI~F~  108 (232)
                      |+|+|||||++|++|||+|++|+.|  |||++++++|++||++|+|++++..+|+||+|+|++ ++.+|+|+|+|||+|.
T Consensus         1 VlDt~G~~l~~G~~YyI~p~~~g~G--GGl~l~~~~n~~CPl~VvQ~~~~~~~GlPV~Fs~~~~~~~ii~e~t~lnI~F~   78 (172)
T smart00452        1 VLDTDGNPLRNGGTYYILPAIRGHG--GGLTLAATGNEICPLTVVQSPNEVDNGLPVKFSPPNPSDFIIRESTDLNIEFD   78 (172)
T ss_pred             CCCCCCCCCcCCCcEEEEEccccCC--CCEEEccCCCCCCCCeeEECCCCCCCceeEEEeecCCCCCEEecCceEEEEeC
Confidence            7999999999999999999999976  899999999999999999999999999999999976 7889999999999999


Q ss_pred             cCCCCCCcCCCCcEEEecCCCcCcceEEEeCC-CCCCcCCeEEEEcccccchhccccCCCCCeEEEeccCCCCCCCCccc
Q 040351          109 RVSSLQQCNKDSLWKVDNDNASLGKQFITIGE-GKTCQNLFKLEKVSASIFDMKIALDIPCLYKIVHCSTPVNGSCDTLC  187 (232)
Q Consensus       109 ~~~~~~~C~~st~W~V~~~d~~~g~~~V~tGg-~~~~~~~FkIeK~~~~~~~~~~~~~~~~~YKLvfCp~~~~~~c~~~C  187 (232)
                      ..   +.|++||+|+|++ ++..++|||+||| .+...|||||||++..          .+.|||+|||..|+   ...|
T Consensus        79 ~~---~~C~~st~W~V~~-~~~~~~~~V~~gg~~~~~~~~FkIek~~~~----------~~~YKLv~Cp~~~~---~~~C  141 (172)
T smart00452       79 AP---PLCAQSTVWTVDE-DSAPEGLAVKTGGYPGVRDSWFKIEKYSGE----------SNGYKLVYCPNGSD---DDKC  141 (172)
T ss_pred             CC---CCCCCCCEEEEec-CCccccEEEEeCCcCCCCCCeEEEEECCCC----------CCCEEEEEcCCCCC---CCcc
Confidence            87   7899999999996 5677899999999 5556799999999842          25799999998764   5789


Q ss_pred             ceeeEEee-CCeeEEEEEcCCCCCCCCeeEEEEEcC
Q 040351          188 KDVGVSNV-DGVQRLVVVDDNDQPNLPLPVVLFPAD  222 (232)
Q Consensus       188 ~dVGi~~d-~g~rrL~l~~d~~~~~~pf~V~F~ka~  222 (232)
                      +|||+++| +|+||||| +++    +||.|+|+|++
T Consensus       142 ~~vGi~~d~~g~rrL~l-s~~----~p~~v~F~k~~  172 (172)
T smart00452      142 GDVGIFIDPEGGRRLVL-SNE----NPLVVVFKKAE  172 (172)
T ss_pred             CccCeEECCCCcEEEEE-cCC----CCeEEEEEECC
Confidence            99999987 89999999 764    39999999985


No 2  
>cd00178 STI Soybean trypsin inhibitor (Kunitz) family of protease inhibitors. Inhibit proteases by binding with high affinity to their active sites. Trefoil fold, common to interleukins and fibroblast growth factors.
Probab=100.00  E-value=1.4e-56  Score=378.78  Aligned_cols=167  Identities=37%  Similarity=0.661  Sum_probs=150.3

Q ss_pred             ceecCCCCcccCCCCEEEEecccCCCCCCceEEecCCCCCCCCceEEcCCCCCCCceEEEecCC-CCcceecccceEEEE
Q 040351           29 PILDVYGNQVDSSHRYYLVSALWGVKTGGGISADKGKNGQCPTDVIQLSPKDKRGKNLVLLPND-NSIIVRESTNIKLKF  107 (232)
Q Consensus        29 ~VlDtdG~~L~~G~~YYIlPa~~g~G~gGGl~l~~t~n~~CPl~VvQ~~~~~~~GlPV~Fsp~~-~~~vI~e~t~lnI~F  107 (232)
                      ||||+|||||++|.+|||+|++||.|  |||++++++|++||++|+|++++..+|+||+|+|++ ++.+|||+++|||+|
T Consensus         1 ~VlD~~G~~l~~g~~YyI~p~~~g~G--GGl~l~~~~~~~CPl~VvQ~~~~~~~GlPv~Fs~~~~~~~~I~e~t~lnI~F   78 (172)
T cd00178           1 PVLDTDGNPLRNGGRYYILPAIRGGG--GGLTLAATGNETCPLTVVQSPSELDRGLPVKFSPPNPKSDVIRESTDLNIEF   78 (172)
T ss_pred             CcCcCCCCCCcCCCeEEEEEceeCCC--CcEEEcCCCCCCCCCeeEECCCCCCCCeeEEEEeCCCCCCEEECCCcEEEEe
Confidence            69999999999999999999999976  999999999999999999999999999999999987 899999999999999


Q ss_pred             ecCCCCCCc-CCCCcEEEecCCCcCcceEEEeCCCC--CCcCCeEEEEcccccchhccccCCCCCeEEEeccCCCCCCCC
Q 040351          108 SRVSSLQQC-NKDSLWKVDNDNASLGKQFITIGEGK--TCQNLFKLEKVSASIFDMKIALDIPCLYKIVHCSTPVNGSCD  184 (232)
Q Consensus       108 ~~~~~~~~C-~~st~W~V~~~d~~~g~~~V~tGg~~--~~~~~FkIeK~~~~~~~~~~~~~~~~~YKLvfCp~~~~~~c~  184 (232)
                      ...   +.| ++|++|+|+++++ .++|||+|||..  +.++||||||++..          .+.|||+|||+.|    +
T Consensus        79 ~~~---~~c~~~st~W~V~~~~~-~~~~~V~~Gg~~~~~~~~~FkIek~~~~----------~~~YKL~~Cp~~~----~  140 (172)
T cd00178          79 DAP---TWCCGSSTVWKVDRDST-PEGLFVTTGGVKGNTLNSWFKIEKVSEG----------LNAYKLVFCPSSC----D  140 (172)
T ss_pred             CCC---CcCCCCCCEEEEeccCC-ccCeEEEeCCcCCCcccceEEEEECCCC----------CCcEEEEEcCCCC----C
Confidence            987   566 9999999997665 789999999943  37999999999852          2679999999864    5


Q ss_pred             cccceeeEEee-CCeeEEEEEcCCCCCCCCeeEEEEE
Q 040351          185 TLCKDVGVSNV-DGVQRLVVVDDNDQPNLPLPVVLFP  220 (232)
Q Consensus       185 ~~C~dVGi~~d-~g~rrL~l~~d~~~~~~pf~V~F~k  220 (232)
                      ..|+|||+++| +|.||||| +++    +||.|+|+|
T Consensus       141 ~~C~~VGi~~d~~g~rrL~l-~~~----~p~~V~F~k  172 (172)
T cd00178         141 SKCGDVGIFIDPEGVRRLVL-SDD----NPLVVVFKK  172 (172)
T ss_pred             CceeecccEECCCCcEEEEE-cCC----CCeEEEEeC
Confidence            68999999987 79999999 764    399999997


No 3  
>PF00197 Kunitz_legume:  Trypsin and protease inhibitor;  InterPro: IPR002160 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  The Kunitz-type soybean trypsin inhibitor (STI) family consists mainly of proteinase inhibitors from Leguminosae seeds []. They belong to MEROPS inhibitor family I3, clan IC. They exhibit proteinase inhibitory activity against serine proteinases; trypsin (MEROPS peptidase family S1, IPR001254 from INTERPRO) and subtilisin (MEROPS peptidase family S8, IPR000209 from INTERPRO), thiol proteinases (MEROPS peptidase family C1, IPR000668 from INTERPRO) and aspartic proteinases (MEROPS peptidase family A1, IPR001461 from INTERPRO) [].  Inhibitors from cereals are active against subtilisin and endogenous alpha-amylases, while some also inhibit tissue plasminogen activator. The inhibitors are usually specific for either trypsin or chymotrypsin, and some are effective against both. They are thought to protect the seeds against consumption by animal predators, while at the same time existing as seed storage proteins themselves - all the actively inhibitory members contain 2 disulphide bridges. The existence of a member with no inhibitory activity, winged bean albumin 1, suggests that the inhibitors may have evolved from seed storage proteins. Proteins from the Kunitz family contain from 170 to 200 amino acid residues and one or two intra-chain disulphide bonds. The best conserved region is found in their N-terminal section. The crystal structures of soybean trypsin inhibitor (STI), trypsin inhibitor DE-3 from the Kaffir tree Erythrina caffra (ETI) [] and the bifunctional proteinase K/alpha-amylase inhibitor from wheat (PK13) have been solved, showing them to share the same 12-stranded beta-sheet structure as those of interleukin-1 and heparin-binding growth factors []. The beta-sheets are arranged in 3 similar lobes around a central axis, 6 strands forming an anti-parallel beta-barrel. Despite the structural similarity, STI shows no interleukin-1 bioactivity, presumably as a result of their primary sequence disparities. The active inhibitory site containing the scissile bond is located in the loop between beta-strands 4 and 5 in STI and ETI. The STIs belong to a superfamily that also contains the interleukin-1 proteins, heparin binding growth factors (HBGF) and histactophilin, all of which have very similar structures, but share no sequence similarity with the STI family.; GO: 0004866 endopeptidase inhibitor activity; PDB: 3TC2_B 3S8J_A 3S8K_A 1TIE_A 2GZB_A 3E8L_C 2IWT_B 3BX1_C 1AVA_D 3IIR_A ....
Probab=100.00  E-value=2.7e-56  Score=377.88  Aligned_cols=169  Identities=34%  Similarity=0.648  Sum_probs=148.0

Q ss_pred             ceecCCCCcccCCCCEEEEecccCCCCCCceEEecCCCCCCCCceEEcCCCCCCCceEEEecC--C-CCcceecccceEE
Q 040351           29 PILDVYGNQVDSSHRYYLVSALWGVKTGGGISADKGKNGQCPTDVIQLSPKDKRGKNLVLLPN--D-NSIIVRESTNIKL  105 (232)
Q Consensus        29 ~VlDtdG~~L~~G~~YYIlPa~~g~G~gGGl~l~~t~n~~CPl~VvQ~~~~~~~GlPV~Fsp~--~-~~~vI~e~t~lnI  105 (232)
                      ||+|+|||||++|++|||+|++|+.|  |||++++++|++||++|+|++++..+|+||+|+|+  . .+++|||+++|||
T Consensus         1 pVlD~~G~~l~~g~~YyI~p~~~~~G--GGl~l~~~~n~~CPl~Vvq~~~~~~~GlPv~Fs~~~~~~~~~~ir~st~l~I   78 (176)
T PF00197_consen    1 PVLDTDGNPLRNGGEYYILPAIRGAG--GGLTLAKTGNETCPLDVVQSPSELSRGLPVKFSPPYRNSFDTVIRESTDLNI   78 (176)
T ss_dssp             B-BETTSCB-BTTSEEEEEESSTGCS--EEEEEECCTTSSSSEEEEEESSTTS-BSEEEEEESSSSSSTBCTBTTSEEEE
T ss_pred             CcCCCCCCCCcCCCCEEEEeCccCCC--CeeEecCCCCCCCChheEEccCCCCCceeEEEEeCCcccCCCeeEcceEEEE
Confidence            79999999999999999999999997  88999999999999999999999999999999993  3 7889999999999


Q ss_pred             EEecCCCCCCcCCCCcEEEecCCCcCcceEEEeCCC---CCCcCCeEEEEcccccchhccccCCCCCeEEEeccCCCCCC
Q 040351          106 KFSRVSSLQQCNKDSLWKVDNDNASLGKQFITIGEG---KTCQNLFKLEKVSASIFDMKIALDIPCLYKIVHCSTPVNGS  182 (232)
Q Consensus       106 ~F~~~~~~~~C~~st~W~V~~~d~~~g~~~V~tGg~---~~~~~~FkIeK~~~~~~~~~~~~~~~~~YKLvfCp~~~~~~  182 (232)
                      +|...   +.|..+++|+|+++++++++ ||+|||.   ++..+||||||++..         ..+.|||+|||..|+  
T Consensus        79 ~F~~~---~~c~~~~~W~V~~~~~~~~~-~V~~gg~~~~~~~~~~FkIek~~~~---------~~~~YKLvfCp~~~~--  143 (176)
T PF00197_consen   79 EFSSP---TSCACSTVWKVVKDDPETGQ-FVKTGGVKGPETVDSWFKIEKYEDG---------FNNAYKLVFCPSVCC--  143 (176)
T ss_dssp             EESSE---CTTSSSSBEEEEEETTTTEE-EEEEESSSSSGCGCCEEEEEEESSS---------STTEEEEEEESSSSS--
T ss_pred             EEccC---CCCCccCEEEEeecCcccce-EEEeCCcccCCccCcEEEEEEeCCC---------CCCcEEEEECCCccc--
Confidence            99987   78999999999987777666 8999993   368999999999851         136899999998753  


Q ss_pred             CCcccceeeEEee-CCeeEEEEEcCCCCCCCCeeEEEEE
Q 040351          183 CDTLCKDVGVSNV-DGVQRLVVVDDNDQPNLPLPVVLFP  220 (232)
Q Consensus       183 c~~~C~dVGi~~d-~g~rrL~l~~d~~~~~~pf~V~F~k  220 (232)
                       ...|+||||++| +|+||||| +++    +||.|+|||
T Consensus       144 -~~~C~dvGi~~d~~g~rrL~l-~~~----~p~~V~F~K  176 (176)
T PF00197_consen  144 -DSLCGDVGIYFDDNGNRRLAL-SDD----NPFVVVFQK  176 (176)
T ss_dssp             -TSSEEEEEEEEETTSEEEEEE-ESS----SB-EEEEEE
T ss_pred             -cCccceeeEEEcCCCeEEEEE-CCC----CcEEEEEEC
Confidence             789999999987 79999999 764    399999998


No 4  
>PF07951 Toxin_R_bind_C:  Clostridium neurotoxin, C-terminal receptor binding;  InterPro: IPR013104 The Clostridium neurotoxin family is composed of tetanus neurotoxins and seven serotypes of botulinum neurotoxin. The structure of the botulinum neurotoxin reveals a four domain protein. The N-terminal catalytic domain (IPR000395 from INTERPRO), the central translocation domains and two receptor-binding domains []. This domain is the C-terminal receptor-binding domain, which adopts a modified beta-trefoil fold with a six stranded beta-barrel and a beta-hairpin triplet capping the domain []. The first step in the intoxication process is a binding event between this domain and the pre-synaptic nerve ending []. ; PDB: 3AZW_A 3N7L_A 3AZV_A 3N7M_A 3RSJ_B 3FUQ_A 3RMX_D 3OBT_A 3RMY_B 3OGG_A ....
Probab=76.45  E-value=7.5  Score=34.44  Aligned_cols=120  Identities=13%  Similarity=0.208  Sum_probs=70.5

Q ss_pred             CCceecCCCCcccCCCCEEEEecccCCC----CCCce-EEecCCCCCCCCceEEcCCCCCCCceEEEecCC----CCcce
Q 040351           27 SEPILDVYGNQVDSSHRYYLVSALWGVK----TGGGI-SADKGKNGQCPTDVIQLSPKDKRGKNLVLLPND----NSIIV   97 (232)
Q Consensus        27 ~~~VlDtdG~~L~~G~~YYIlPa~~g~G----~gGGl-~l~~t~n~~CPl~VvQ~~~~~~~GlPV~Fsp~~----~~~vI   97 (232)
                      +..+.|==||||+-..+||++++..-.-    ...++ ....++.. =-+.+.-..+++-.|++|++....    .+..|
T Consensus         7 ~niLKDfWGN~L~YdkeYYl~N~~~~n~yi~~~~~~~~~~n~~r~~-~~~ni~~n~r~LY~G~k~iIkr~~~~~~~Dn~V   85 (214)
T PF07951_consen    7 TNILKDFWGNYLRYDKEYYLLNVLYPNKYIKRKSDSILSINNQRGT-GVFNIYLNYRDLYTGIKFIIKRYADNSNNDNRV   85 (214)
T ss_dssp             TTB-BBTTSSB-BTTSEEEEEESSSTTEEEEEETTSEEEEEEEEEE-EEEEEESEETSSSSS-EEEEEESSTSSSTSSB-
T ss_pred             ccHHHHhcCCccccCceeEEEecCCcccceeecccceeeecccccc-cceeeeeeehhhccCceEEEEEccCCCCCccee
Confidence            4688899999999999999999865321    00222 22221111 011233334457799999998742    78899


Q ss_pred             ecccceEEEEecCCCCCCcCCCCcEEEec---C--CCcCcceEEEeCC---CC-CC--cCCeEEEEccc
Q 040351           98 RESTNIKLKFSRVSSLQQCNKDSLWKVDN---D--NASLGKQFITIGE---GK-TC--QNLFKLEKVSA  155 (232)
Q Consensus        98 ~e~t~lnI~F~~~~~~~~C~~st~W~V~~---~--d~~~g~~~V~tGg---~~-~~--~~~FkIeK~~~  155 (232)
                      |.+..+.|.|...        ...|.|--   +  +.+..+-.+.+.+   .. ..  -..|+|++..+
T Consensus        86 r~~D~iy~n~~~~--------n~ey~l~~~~~Y~~~~~~~~kli~l~~l~~~~~~~~~~~vmqik~~~~  146 (214)
T PF07951_consen   86 RNGDYIYFNVVIN--------NKEYRLYADTMYKNSKNQSEKLIYLLRLSDSNDNINQYIVMQIKNYNS  146 (214)
T ss_dssp             BTTEEEEEEEEET--------TEEEEEEEETEECTTSSSSEEEEEEEEEECSCTTTCEECEEEEEEEEE
T ss_pred             ecCCEEEEEEEeC--------CceEEEEeeeecccccccchheeeEEecccCCCCcCceEEEEEEeccc
Confidence            9999999999765        56799821   1  1222234454444   21 11  24799999864


No 5  
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms]
Probab=53.54  E-value=13  Score=33.37  Aligned_cols=55  Identities=24%  Similarity=0.266  Sum_probs=35.9

Q ss_pred             CCCcccCCCCEEEEecccCCC-----CCCceEEecCCCCCCCCceEEcCCC-CCCCceEEEec
Q 040351           34 YGNQVDSSHRYYLVSALWGVK-----TGGGISADKGKNGQCPTDVIQLSPK-DKRGKNLVLLP   90 (232)
Q Consensus        34 dG~~L~~G~~YYIlPa~~g~G-----~gGGl~l~~t~n~~CPl~VvQ~~~~-~~~GlPV~Fsp   90 (232)
                      .|.+-++|.+||+++...|.-     +-||+-  .+.+.+|-..|.|++.. ...=.++.+.|
T Consensus       117 ~G~EF~pG~~YY~IStStg~~~g~~~~~ggvc--~~~~mk~~~~V~~~~~~~~~~~~~~~~~p  177 (233)
T KOG3858|consen  117 LGFEFQPGHTYYYISTSTGDAEGLCNLRGGVC--VTRNMKLLMKVGQSPRSGVTPEKPVSEEP  177 (233)
T ss_pred             CCccccCCCeEEEEeCCCccccccchhhCCEe--ccCCceEEEEecccCCCCccccccccccc
Confidence            699999999999999876642     123444  34466787888888653 11223555544


No 6  
>PF02402 Lysis_col:  Lysis protein;  InterPro: IPR003059 The DNA sequence of the entire colicin E2 operon has been determined []. The operon comprises the colicin activity gene (ceaB), the colicin immunity gene (ceiB) and the lysis gene (celB), which is essential for colicin release from producing cells []. A putative LexA binding site is located upstream from ceaB, and a rho-independent terminator structure is located downstream from celB []. Comparison of the amino acid sequences of colicin E2 and cloacin DF13 reveal extensive similarity. These colicins have different modes of action and recognise different cell surface receptors; the two major regions of heterology at the C terminus, and in the C-terminal end of the central region are thought to correspond to the catalytic and receptor-recognition domains, respectively [].  Sequence similarities between colicins E2, A and E1 [] are less striking. The colicin E2 (pyocin) immunity protein does not share similarity with either the colicin E3 or cloacin DF13 [] immunity proteins. By contrast, the lysis proteins of the ColE2, ColE1 and CloDF13 plasmids are almost identical except in the N-terminal regions, which themselves are similar to lipoprotein signal peptides []. Processing of the ColE2 prolysis protein to the mature form is prevented by globomycin, a specific inhibitor of the lipoprotein signal peptidase []. The mature ColE2 lysis protein is located in the cell envelope [].; GO: 0009405 pathogenesis, 0019835 cytolysis, 0019867 outer membrane
Probab=45.35  E-value=18  Score=24.48  Aligned_cols=19  Identities=37%  Similarity=0.419  Sum_probs=15.2

Q ss_pred             CCCCCceecCCCCcccCCC
Q 040351           24 ASESEPILDVYGNQVDSSH   42 (232)
Q Consensus        24 ~a~~~~VlDtdG~~L~~G~   42 (232)
                      +.+.+.|.|+.|--+.+..
T Consensus        18 aCQaN~iRDvqGGtVaPSS   36 (46)
T PF02402_consen   18 ACQANYIRDVQGGTVAPSS   36 (46)
T ss_pred             HhhhcceecCCCceECCCc
Confidence            5678899999998887653


No 7  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=39.62  E-value=18  Score=27.93  Aligned_cols=8  Identities=38%  Similarity=0.351  Sum_probs=3.5

Q ss_pred             cchhHHHH
Q 040351            2 KTSLVTTL    9 (232)
Q Consensus         2 K~~~~~~l    9 (232)
                      |+.+||.|
T Consensus         4 K~~llL~l   11 (95)
T PF07172_consen    4 KAFLLLGL   11 (95)
T ss_pred             hHHHHHHH
Confidence            34444444


No 8  
>PF14009 DUF4228:  Domain of unknown function (DUF4228)
Probab=37.12  E-value=21  Score=28.79  Aligned_cols=21  Identities=10%  Similarity=0.143  Sum_probs=17.2

Q ss_pred             CCCCcccCCCCEEEEecccCC
Q 040351           33 VYGNQVDSSHRYYLVSALWGV   53 (232)
Q Consensus        33 tdG~~L~~G~~YYIlPa~~g~   53 (232)
                      .-.++|++|.-||++|..+-.
T Consensus        64 ~~d~~L~~G~~Y~llP~~~~~   84 (181)
T PF14009_consen   64 PPDEELQPGQIYFLLPMSRLQ   84 (181)
T ss_pred             CccCeecCCCEEEEEEccccC
Confidence            456789999999999987643


No 9  
>COG5341 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.03  E-value=2.5e+02  Score=23.15  Aligned_cols=18  Identities=11%  Similarity=0.126  Sum_probs=11.4

Q ss_pred             CCcceecccceEEEEecC
Q 040351           93 NSIIVRESTNIKLKFSRV  110 (232)
Q Consensus        93 ~~~vI~e~t~lnI~F~~~  110 (232)
                      .+++|-.-..|-|++...
T Consensus       103 GetIVclPh~lvIev~~~  120 (132)
T COG5341         103 GETIVCLPHKLVIEVKSK  120 (132)
T ss_pred             CCEEEEcCCeEEEEEEcc
Confidence            455666666677777654


No 10 
>PF05474 Semenogelin:  Semenogelin;  InterPro: IPR008836 This family consists of several mammalian semenogelin (I and II) proteins. Freshly ejaculated Homo sapiens semen has the appearance of a loose gel in which the predominant structural protein components are the seminal vesicle secreted semenogelins (Sg) [].; GO: 0005198 structural molecule activity, 0019953 sexual reproduction, 0005576 extracellular region, 0030141 stored secretory granule
Probab=32.34  E-value=23  Score=35.25  Aligned_cols=15  Identities=33%  Similarity=0.545  Sum_probs=12.1

Q ss_pred             CcchhHHHHHHHHHH
Q 040351            1 MKTSLVTTLSFLILA   15 (232)
Q Consensus         1 MK~~~~~~lsfll~a   15 (232)
                      ||++++|.||+||++
T Consensus         1 MK~~I~F~lSLLLiL   15 (582)
T PF05474_consen    1 MKSIIFFVLSLLLIL   15 (582)
T ss_pred             CCceeehHHHHHHHH
Confidence            999988888876654


No 11 
>PF08194 DIM:  DIM protein;  InterPro: IPR013172 Drosophila immune-induced molecules (DIMs) are short proteins induced during the immune response of Drosophila []. This entry includes DIMs 1 to 4 and DIM23.
Probab=32.13  E-value=62  Score=20.94  Aligned_cols=16  Identities=38%  Similarity=0.586  Sum_probs=9.1

Q ss_pred             CcchhHHHHHHHHHHHh
Q 040351            1 MKTSLVTTLSFLILALT   17 (232)
Q Consensus         1 MK~~~~~~lsfll~a~~   17 (232)
                      ||...+ ++.++++|++
T Consensus         1 Mk~l~~-a~~l~lLal~   16 (36)
T PF08194_consen    1 MKCLSL-AFALLLLALA   16 (36)
T ss_pred             CceeHH-HHHHHHHHHH
Confidence            887765 2335555554


No 12 
>PF05550 Peptidase_C53:  Pestivirus Npro endopeptidase C53;  InterPro: IPR008751 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to MEROPS peptidase family C53 (clan C-). The active site residues occur in the order E, H, C in the sequence which is unlike that in any other family. They are unique to pestiviruses. The N-terminal cysteine peptidase (Npro) encoded by the bovine viral diarrhoea virus genome is responsible for the self-cleavage that releases the N terminus of the core protein. This unique protease is dispensable for viral replication, and its coding region can be replaced by a ubiquitin gene directly fused in frame to the core [, , , ].; GO: 0016032 viral reproduction, 0019082 viral protein processing
Probab=30.27  E-value=35  Score=28.84  Aligned_cols=25  Identities=32%  Similarity=0.320  Sum_probs=18.4

Q ss_pred             hcCCCCCCCCCCceecCCCCcccCC
Q 040351           17 TTKPQLGASESEPILDVYGNQVDSS   41 (232)
Q Consensus        17 ~t~~~l~~a~~~~VlDtdG~~L~~G   41 (232)
                      -|+..-|+...|||+|..|+||.-.
T Consensus        11 kt~kq~P~Gv~EPVyd~~g~plfGe   35 (168)
T PF05550_consen   11 KTYKQKPAGVEEPVYDSAGNPLFGE   35 (168)
T ss_pred             hhcCCCCcccccccccCCCCCccCC
Confidence            3444445566799999999999864


No 13 
>PF00879 Defensin_propep:  Defensin propeptide The pattern for this Prosite entry doesn't match the propeptide.;  InterPro: IPR002366 Defensins are 2-6 kDa, cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses [], containing three pairs of intramolecular disulphide bonds []. On the basis of their size and pattern of disulphide bonding, mammalian defensins are classified into alpha, beta and theta categories. Alpha-defensins, which have been identified in humans, monkeys and several rodent species, are particularly abundant in neutrophils, certain macrophage populations and Paneth cells of the small intestine. Every mammalian species explored thus far has beta-defensins. In cows, as many as 13 beta-defensins exist in neutrophils. However, in other species, beta-defensins are more often produced by epithelial cells lining various organs (e.g. the epidermis, bronchial tree and genitourinary tract). Theta-defensins are cyclic and have so far only been identified in primate phagocytes.   Defensins are produced constitutively and/or in response to microbial products or proinflammatory cytokines. Some defensins are also called corticostatins (CS) because they inhibit corticotropin-stimulated corticosteroid production. The mechanism(s) by which microorganisms are killed and/or inactivated by defensins is not understood completely. However, it is generally believed that killing is a consequence of disruption of the microbial membrane. The polar topology of defensins, with spatially separated charged and hydrophobic regions, allows them to insert themselves into the phospholipid membranes so that their hydrophobic regions are buried within the lipid membrane interior and their charged (mostly cationic) regions interact with anionic phospholipid head groups and water. Subsequently, some defensins can aggregate to form `channel-like' pores; others might bind to and cover the microbial membrane in a `carpet-like' manner. The net outcome is the disruption of membrane integrity and function, which ultimately leads to the lysis of microorganisms. Some defensins are synthesized as propeptides which may be relevant to this process - in neutrophils only the mature peptides have been identified but in Paneth cells, the propeptide is stored in vesicles [] and appears to be cleaved by trypsin on activation.  ; GO: 0006952 defense response
Probab=29.91  E-value=54  Score=22.87  Aligned_cols=18  Identities=33%  Similarity=0.508  Sum_probs=12.5

Q ss_pred             CcchhHHHHHHHHHHHhcC
Q 040351            1 MKTSLVTTLSFLILALTTK   19 (232)
Q Consensus         1 MK~~~~~~lsfll~a~~t~   19 (232)
                      ||+..||+- .||+||-+.
T Consensus         1 MRTL~LLaA-lLLlAlqaQ   18 (52)
T PF00879_consen    1 MRTLALLAA-LLLLALQAQ   18 (52)
T ss_pred             CcHHHHHHH-HHHHHHHHh
Confidence            888766544 678887654


No 14 
>PF09466 Yqai:  Hypothetical protein Yqai;  InterPro: IPR018474 The hypothetical protein YqaI is expressed in bacteria, particularly Bacillus subtilis. It forms a homo-dimer, with each monomer containing an alpha helix and four beta strands.; PDB: 2DSM_B.
Probab=29.69  E-value=41  Score=24.94  Aligned_cols=21  Identities=29%  Similarity=0.744  Sum_probs=12.2

Q ss_pred             CceecCCCCcccCCCCEEEEe
Q 040351           28 EPILDVYGNQVDSSHRYYLVS   48 (232)
Q Consensus        28 ~~VlDtdG~~L~~G~~YYIlP   48 (232)
                      -++.|.-|+++.+|.+|+|.|
T Consensus        24 ~~i~D~yG~EI~~~D~y~i~~   44 (71)
T PF09466_consen   24 HPIEDFYGDEIFPGDDYFISP   44 (71)
T ss_dssp             -B---TTSS-B-TTS-EEE-E
T ss_pred             cceeeeeccccccCCeEEEeC
Confidence            378899999999999999966


No 15 
>PRK11354 kil FtsZ inhibitor protein; Reviewed
Probab=27.89  E-value=41  Score=24.95  Aligned_cols=47  Identities=21%  Similarity=0.144  Sum_probs=32.7

Q ss_pred             CCcccCCCCEEEEecccCCCCCCceEEecCCCCC----CCCceEEcCCCCCCCceEE
Q 040351           35 GNQVDSSHRYYLVSALWGVKTGGGISADKGKNGQ----CPTDVIQLSPKDKRGKNLV   87 (232)
Q Consensus        35 G~~L~~G~~YYIlPa~~g~G~gGGl~l~~t~n~~----CPl~VvQ~~~~~~~GlPV~   87 (232)
                      |.-+.-.+++|+.+|..-..  |.|+|......+    |-..|..+    .+|.|++
T Consensus        19 G~~v~~~grty~ASAN~~~r--~~LYl~~~~e~~~i~d~~IeVyL~----~~G~Plt   69 (73)
T PRK11354         19 GDYVLHEGRTYIASANNIKK--RKLYIRTLTTKTCITDCMIKVFLG----RDGLPVK   69 (73)
T ss_pred             ceEEEEcCcEEEEEechhhC--ceEEEEeeeEEEEEeeeEEEEEEc----CCCCccc
Confidence            66677778999999864454  799987643333    66666655    4788885


No 16 
>COG4851 CamS Protein involved in sex pheromone biosynthesis [General function prediction only]
Probab=27.25  E-value=63  Score=30.57  Aligned_cols=59  Identities=19%  Similarity=0.276  Sum_probs=32.6

Q ss_pred             CcchhHHHHHHHHHHHhcCCCCCCCCCCceecCCCCccc----------CCCCEE--EEecccCCCCCCceEE
Q 040351            1 MKTSLVTTLSFLILALTTKPQLGASESEPILDVYGNQVD----------SSHRYY--LVSALWGVKTGGGISA   61 (232)
Q Consensus         1 MK~~~~~~lsfll~a~~t~~~l~~a~~~~VlDtdG~~L~----------~G~~YY--IlPa~~g~G~gGGl~l   61 (232)
                      ||.++.+++-=+.|.|+........+.+.|.+.+|++-.          ....||  ++|-..|..  -||..
T Consensus         1 Mkktl~i~~ta~vliLs~C~~~~dd~edkv~qk~~~sseq~k~Iv~k~nis~n~YktvLpyk~~ka--RGl~~   71 (382)
T COG4851           1 MKKTLGIAATASVLILSGCFPFVDDTEDKVVQKEGKSSEQEKGIVPKANISENYYKTVLPYKAGKA--RGLGS   71 (382)
T ss_pred             CchhhhHHHHHHHHHHhhccCccCCccchhhhccCCchhhcccccccccccccchheeeeeccccc--cchhh
Confidence            888765433111122222221223456788888888766          246788  888766654  34443


No 17 
>PRK10220 hypothetical protein; Provisional
Probab=26.51  E-value=79  Score=25.35  Aligned_cols=27  Identities=19%  Similarity=0.099  Sum_probs=20.8

Q ss_pred             CceecCCCCcccCCCCEEEEecccCCC
Q 040351           28 EPILDVYGNQVDSSHRYYLVSALWGVK   54 (232)
Q Consensus        28 ~~VlDtdG~~L~~G~~YYIlPa~~g~G   54 (232)
                      ..|.|.+|++|..|.+--++=.+.=.|
T Consensus        42 ~~vkDsnG~~L~dGDsV~viKDLkVKG   68 (111)
T PRK10220         42 LIVKDANGNLLADGDSVTIVKDLKVKG   68 (111)
T ss_pred             ceEEcCCCCCccCCCEEEEEeeccccc
Confidence            468999999999998887776544343


No 18 
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=25.68  E-value=85  Score=25.11  Aligned_cols=27  Identities=19%  Similarity=0.128  Sum_probs=20.8

Q ss_pred             CceecCCCCcccCCCCEEEEecccCCC
Q 040351           28 EPILDVYGNQVDSSHRYYLVSALWGVK   54 (232)
Q Consensus        28 ~~VlDtdG~~L~~G~~YYIlPa~~g~G   54 (232)
                      ..|.|.+|++|..|.+--|+=.+.=.|
T Consensus        41 ~~~kDsnG~~L~dGDsV~liKDLkVKG   67 (109)
T TIGR00686        41 LIVKDCNGNLLANGDSVILIKDLKVKG   67 (109)
T ss_pred             ceEEcCCCCCccCCCEEEEEeeccccC
Confidence            468999999999998887776554343


No 19 
>TIGR02052 MerP mercuric transport protein periplasmic component. This model represents the periplasmic mercury (II) binding protein of the bacterial mercury detoxification system which passes mercuric ion to the MerT transporter for subsequent reduction to Hg(0) by the mercuric reductase MerA. MerP contains a distinctive GMTCXXC motif associated with metal binding. MerP is related to a larger family of metal binding proteins (pfam00403).
Probab=24.91  E-value=47  Score=22.77  Aligned_cols=14  Identities=43%  Similarity=0.548  Sum_probs=7.5

Q ss_pred             CcchhHHHHHHHHHHHh
Q 040351            1 MKTSLVTTLSFLILALT   17 (232)
Q Consensus         1 MK~~~~~~lsfll~a~~   17 (232)
                      ||..+  +| |+||.++
T Consensus         1 ~~~~~--~~-~~~~~~~   14 (92)
T TIGR02052         1 MKKLA--TL-LALFVLT   14 (92)
T ss_pred             ChhHH--HH-HHHHHHh
Confidence            88764  33 4444444


No 20 
>COG5510 Predicted small secreted protein [Function unknown]
Probab=23.04  E-value=64  Score=21.76  Aligned_cols=17  Identities=18%  Similarity=0.251  Sum_probs=9.5

Q ss_pred             CcchhHHHHHHHHHHHh
Q 040351            1 MKTSLVTTLSFLILALT   17 (232)
Q Consensus         1 MK~~~~~~lsfll~a~~   17 (232)
                      ||.+.++.+++++.++.
T Consensus         2 mk~t~l~i~~vll~s~l   18 (44)
T COG5510           2 MKKTILLIALVLLASTL   18 (44)
T ss_pred             chHHHHHHHHHHHHHHH
Confidence            77766555545555443


No 21 
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=22.84  E-value=1e+02  Score=24.68  Aligned_cols=27  Identities=19%  Similarity=0.096  Sum_probs=21.4

Q ss_pred             CceecCCCCcccCCCCEEEEecccCCC
Q 040351           28 EPILDVYGNQVDSSHRYYLVSALWGVK   54 (232)
Q Consensus        28 ~~VlDtdG~~L~~G~~YYIlPa~~g~G   54 (232)
                      ..|.|.+||.|..|.+-.|+-...=.|
T Consensus        43 ~~v~DsnGn~L~dGDsV~lIKDLkVKG   69 (112)
T COG2824          43 LIVKDSNGNLLADGDSVTLIKDLKVKG   69 (112)
T ss_pred             eEEEcCCCcEeccCCeEEEEEeeeecC
Confidence            589999999999998888776554343


No 22 
>PRK10159 outer membrane phosphoporin protein E; Provisional
Probab=22.59  E-value=51  Score=30.66  Aligned_cols=36  Identities=19%  Similarity=0.385  Sum_probs=20.9

Q ss_pred             CcchhHHHHHHHHHHHhcCCCCCCCCCCceecCCCCcccCCC
Q 040351            1 MKTSLVTTLSFLILALTTKPQLGASESEPILDVYGNQVDSSH   42 (232)
Q Consensus         1 MK~~~~~~lsfll~a~~t~~~l~~a~~~~VlDtdG~~L~~G~   42 (232)
                      ||.+++ +|.  +++++..+   ++.+.+|+|.||.-|...+
T Consensus         1 Mkk~l~-a~~--~~a~~~~~---~a~A~~vy~~d~ssvtlyG   36 (351)
T PRK10159          1 MKKSTL-ALV--VMGIVASA---SVQAAEVYNKDGNKLDVYG   36 (351)
T ss_pred             CchhhH-HHH--HHHHHHhc---cccEEEEEECCCCEEEEEE
Confidence            898764 332  23222111   2455789999997777643


No 23 
>PF00812 Ephrin:  Ephrin;  InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO). These receptors and their ligands have been implicated in regulating neuronal axon guidance and in patterning of the developing nervous system and may also serve a patterning and compartmentalisation role outside of the nervous system as well. Ephrins are membrane-attached proteins of 205 to 340 residues. Attachment appears to be crucial for their normal function. Type-A ephrins are linked to the membrane via a glycosylphosphatidylinositol (GPI)-linkage, while type-B ephrins are type-I membrane proteins.; GO: 0016020 membrane; PDB: 3HEI_P 3CZU_B 3MBW_B 1KGY_E 1IKO_P 2WO3_B 2I85_A 2VSK_B 3GXU_B 2VSM_B ....
Probab=22.44  E-value=55  Score=27.23  Aligned_cols=21  Identities=29%  Similarity=0.585  Sum_probs=16.5

Q ss_pred             CCCcccCCCCEEEEecccCCC
Q 040351           34 YGNQVDSSHRYYLVSALWGVK   54 (232)
Q Consensus        34 dG~~L~~G~~YYIlPa~~g~G   54 (232)
                      .|-+-++|.+||++....|.-
T Consensus       101 ~G~EF~pG~~YY~ISts~g~~  121 (145)
T PF00812_consen  101 LGLEFQPGHDYYYISTSTGTQ  121 (145)
T ss_dssp             TSSS--TTEEEEEEEEESSSS
T ss_pred             CCeeecCCCeEEEEEccCCCC
Confidence            799999999999999887753


No 24 
>PLN03207 stomagen; Provisional
Probab=21.86  E-value=43  Score=26.51  Aligned_cols=8  Identities=50%  Similarity=0.716  Sum_probs=3.1

Q ss_pred             HHHHHHHH
Q 040351            8 TLSFLILA   15 (232)
Q Consensus         8 ~lsfll~a   15 (232)
                      .|.||||+
T Consensus        14 ~lffLl~~   21 (113)
T PLN03207         14 TLFFLLFF   21 (113)
T ss_pred             HHHHHHHH
Confidence            33344433


No 25 
>PF03831 PhnA:  PhnA protein;  InterPro: IPR013988 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the C-terminal domain of PhnA.; PDB: 2AKK_A 2AKL_A.
Probab=20.90  E-value=52  Score=23.33  Aligned_cols=21  Identities=24%  Similarity=0.431  Sum_probs=11.8

Q ss_pred             eecCCCCcccCCCCEEEEecc
Q 040351           30 ILDVYGNQVDSSHRYYLVSAL   50 (232)
Q Consensus        30 VlDtdG~~L~~G~~YYIlPa~   50 (232)
                      |.|.+|++|..|.+--++--.
T Consensus         2 v~DsnGn~L~dGDsV~~iKDL   22 (56)
T PF03831_consen    2 VKDSNGNELQDGDSVTLIKDL   22 (56)
T ss_dssp             -B-TTS-B--TTEEEEESS-E
T ss_pred             eEcCCCCCccCCCEEEEEeee
Confidence            789999999999877765443


Done!