BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 040357
         (144 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4HEC|A Chain A, Crystal Structure Of A Putative Uncharacterized Protein
           From Mycobacterium Tuberculosis
 pdb|4HEC|B Chain B, Crystal Structure Of A Putative Uncharacterized Protein
           From Mycobacterium Tuberculosis
 pdb|4HVJ|A Chain A, Crystal Structure Of A Putative Uncharacterized Protein
           From Mycobacterium Tuberculosis In Complex With Amp
 pdb|4HVJ|B Chain B, Crystal Structure Of A Putative Uncharacterized Protein
           From Mycobacterium Tuberculosis In Complex With Amp
          Length = 190

 Score = 26.6 bits (57), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 7/55 (12%)

Query: 71  TVSLLIMGFLASGGFGVAAISVL-------SWIYRYVTGGHPPGADQLEQARMKL 118
           T+ L+ +G +A  G    A+S         SW+  +V    PP A QL ++R ++
Sbjct: 37  TIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQI 91


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.137    0.400 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,001,078
Number of Sequences: 62578
Number of extensions: 99744
Number of successful extensions: 169
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 169
Number of HSP's gapped (non-prelim): 3
length of query: 144
length of database: 14,973,337
effective HSP length: 89
effective length of query: 55
effective length of database: 9,403,895
effective search space: 517214225
effective search space used: 517214225
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 46 (22.3 bits)