Query         040362
Match_columns 356
No_of_seqs    113 out of 144
Neff          3.6 
Searched_HMMs 46136
Date          Fri Mar 29 07:43:06 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/040362.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/040362hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04833 COBRA:  COBRA-like pro 100.0 4.2E-75 9.2E-80  519.5  16.4  148    8-155     1-169 (169)
  2 PF00553 CBM_2:  Cellulose bind  91.6    0.46   1E-05   39.0   5.5   85    5-114    12-98  (101)
  3 PF00553 CBM_2:  Cellulose bind  84.4     5.8 0.00013   32.5   7.6   99  203-319     3-101 (101)
  4 smart00637 CBD_II CBD_II domai  79.6       5 0.00011   32.0   5.4   46    3-52      4-49  (92)
  5 PF03128 CXCXC:  CXCXC repeat;   55.0     6.1 0.00013   22.8   0.7    8  180-187     7-14  (14)
  6 PF10563 CdCA1:  Cadmium carbon  47.1     3.8 8.2E-05   39.4  -1.5   14  197-210     5-18  (218)
  7 smart00141 PDGF Platelet-deriv  46.2      31 0.00067   28.4   3.9   21   64-84      2-22  (83)
  8 PF11403 Yeast_MT:  Yeast metal  36.8      26 0.00055   25.3   1.7    8  182-189     9-17  (40)
  9 COG5341 Uncharacterized protei  34.0      44 0.00096   30.1   3.2   39  283-321    45-83  (132)
 10 PF10609 ParA:  ParA/MinD ATPas  30.2      27 0.00059   28.7   1.2   15   70-85      4-18  (81)
 11 cd00135 PDGF Platelet-derived   30.0   1E+02  0.0022   25.3   4.4   18   64-81      2-19  (86)
 12 PF02718 Herpes_UL31:  Herpesvi  23.4      55  0.0012   32.3   2.1   29  158-186    65-96  (258)
 13 PHA02661 vascular endothelial   23.2 1.1E+02  0.0023   27.9   3.8   25   61-85     44-68  (146)

No 1  
>PF04833 COBRA:  COBRA-like protein;  InterPro: IPR006918 In Arabidopsis thaliana (Mouse-ear cress) members of the family are all extracellular glycosyl-phosphatidyl inositol-anchored proteins (GPI-linked) []. The type example of the family is COBRA (Q94KT8 from SWISSPROT) and the family is generally annotated as COBRA-like (COBL). COBRA is involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition. It may act by recruiting cellulose synthesizing complexes to discrete positions on the cell surface. Some members of this family are annotated as phytochelatin synthase, but these annotations are incorrect [].
Probab=100.00  E-value=4.2e-75  Score=519.51  Aligned_cols=148  Identities=60%  Similarity=1.097  Sum_probs=145.2

Q ss_pred             eEEEEEEecCccccccCCCCCeeeeeecCCeeEEeeccceEeecCCeeeec--CCccccccCCCeEEeCCCCCCCCceee
Q 040362            8 YVALVTINNIQMYRSIMTPGWTLGWMWAKKEVIWSIVGAQATDQGDCSKFK--NNIPHCCRRNPVIVDLLPGVPMNQQFI   85 (356)
Q Consensus         8 Y~A~VTi~N~q~~r~i~~pgW~L~W~W~~~E~IwsM~GA~~t~qgdC~~~k--~~~p~~C~k~P~IvDL~P~~~~d~qi~   85 (356)
                      |+|+|||+|||+|||||.|||+|||+|+|+||||+|+||||+|||||++|+  +++||||+|+|+|||||||+|+|+|||
T Consensus         1 Y~A~VTi~N~~~yr~id~pgW~L~W~W~~~E~IwsM~GA~~tdqgdCs~~~~~~~~ph~C~k~P~IvDLpp~~~~n~qi~   80 (169)
T PF04833_consen    1 YVAQVTISNYQPYRHIDNPGWNLGWTWAKKEFIWSMKGAQTTDQGDCSKFYKDGDFPHCCKKRPTIVDLPPGTPYNQQIG   80 (169)
T ss_pred             CEEEEEEecCCeecccCCCCceEeeEEcCCEEEEEeeCceeccCCcccccccCCCCCcccCCCCEEEeCCCCCCCccccc
Confidence            999999999999999999999999999999999999999999999999998  889999999999999999999999999


Q ss_pred             -----------------eeEEEEEEEeec--CCCCCcccCCcCeEEeCCCCCcccCCceeeCCccccCCCCcceeeEeee
Q 040362           86 -----------------YIVAKVLRVGLS--GTSNKTVRLPKNFYIFGPGPGYTCGAATIMVPTSFFSSNGRRKTYAMMT  146 (356)
Q Consensus        86 -----------------s~s~FQm~Vg~~--~~~n~t~~~P~nf~l~~pgPgYtCg~~~~V~Pt~f~~p~g~r~t~Al~T  146 (356)
                                       |+|+|||+||++  +++|++++||+||+|++|||||+||+|++|+||+|+|+||||+||||||
T Consensus        81 nCCrgG~l~~~~~Dps~s~S~FQm~Vg~~pp~~~~~~~~~P~nf~l~~~~pgYtCg~~~~V~pT~f~~~~g~r~t~A~~T  160 (169)
T PF04833_consen   81 NCCRGGVLSSWAQDPSKSVSAFQMSVGKAPPGTNNTTVKPPQNFTLGGPGPGYTCGPPKRVSPTVFPDPDGRRTTQALMT  160 (169)
T ss_pred             cccCCCEECCcccChhhCceEEEEEEeEeeccCCCceecCCcceEEcCCCCCcCCCCcceeCCceeeCCCCCEEEEEEEE
Confidence                             999999999998  7777889999999999999999999999999999999999999999999


Q ss_pred             eeeEEeeec
Q 040362          147 WTVTCTYSQ  155 (356)
Q Consensus       147 WqVtC~ysq  155 (356)
                      |||||||||
T Consensus       161 WqvtC~ysq  169 (169)
T PF04833_consen  161 WQVTCNYSQ  169 (169)
T ss_pred             EeEEEEeeC
Confidence            999999997


No 2  
>PF00553 CBM_2:  Cellulose binding domain;  InterPro: IPR001919 The microbial degradation of cellulose and xylans requires several types of enzyme such as endoglucanases (3.2.1.4 from EC), cellobiohydrolases (3.2.1.91 from EC) (exoglucanases), or xylanases (3.2.1.8 from EC) []. Structurally, cellulases and xylanases generally consist of a catalytic domain joined to a cellulose-binding domain (CBD) by a short linker sequence rich in proline and/or hydroxy-amino acids. The CBD domain is found either at the N-terminal or at the C-terminal extremity of these enzymes. As it is shown in the following schematic representation, there are two conserved cysteines in this CBD domain - one at each extremity of the domain - which have been shown [] to be involved in a disulphide bond. There are also four conserved tryptophan, two are involved in cellulose binding. The CBD of a number of bacterial cellulases has been shown to consist of about 105 amino acid residues [, ].  +-------------------------------------------------+ | | xCxxxxWxxxxxNxxxWxxxxxxxWxxxxxxxxWNxxxxxGxxxxxxxxxxCx 'C': conserved cysteine involved in a disulphide bond. ; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0030246 carbohydrate binding, 0005975 carbohydrate metabolic process; PDB: 2CZN_A 2CWR_A 1HEH_C 1HEJ_C 3NDZ_E 3NDY_E 2XBD_A 1E5C_A 1XBD_A 1E5B_A ....
Probab=91.59  E-value=0.46  Score=39.00  Aligned_cols=85  Identities=21%  Similarity=0.271  Sum_probs=57.6

Q ss_pred             CCceEEEEEEecCccccccCCCCCeeeeeecCCeeEEeeccceEeecCCeeeecCCccccccCCCeEEeCCCCCCCCcee
Q 040362            5 ADGYVALVTINNIQMYRSIMTPGWTLGWMWAKKEVIWSIVGAQATDQGDCSKFKNNIPHCCRRNPVIVDLLPGVPMNQQF   84 (356)
Q Consensus         5 ~~~Y~A~VTi~N~q~~r~i~~pgW~L~W~W~~~E~IwsM~GA~~t~qgdC~~~k~~~p~~C~k~P~IvDL~P~~~~d~qi   84 (356)
                      .+||.++|+|.|... ..|+  ||+|.|+-..++-|=++.+|..+..|.=..+                -+  ..+|..|
T Consensus        12 ~~Gf~~~v~v~N~~~-~~i~--~W~v~~~~~~~~~i~~~Wna~~s~~g~~~~v----------------~~--~~wn~~i   70 (101)
T PF00553_consen   12 GGGFQGEVTVTNNGS-SPIN--GWTVTFTFPSGQTITSSWNATVSQSGNTVTV----------------TN--PSWNGTI   70 (101)
T ss_dssp             SSEEEEEEEEEESSS-STEE--SEEEEEEESTTEEEEEEESCEEEEETTEEEE----------------EE--SSTCSEE
T ss_pred             CCCeEEEEEEEECCC-CccC--CEEEEEEeCCCCEEeeeeccEEEecCCEEEE----------------Ec--CCcCccc
Confidence            589999999999877 4555  8999999998898889999988765431111                11  2356666


Q ss_pred             e--eeEEEEEEEeecCCCCCcccCCcCeEEeC
Q 040362           85 I--YIVAKVLRVGLSGTSNKTVRLPKNFYIFG  114 (356)
Q Consensus        85 ~--s~s~FQm~Vg~~~~~n~t~~~P~nf~l~~  114 (356)
                      +  +..+|=+++...+.    ..+|.+.+|.|
T Consensus        71 ~~G~s~~~Gf~~~~~~~----~~~p~~~t~ng   98 (101)
T PF00553_consen   71 APGGSVTFGFQASGSGS----SAAPSTCTVNG   98 (101)
T ss_dssp             EESEEEEEEEEEEESSS------SESEEEETT
T ss_pred             CCCCeEEEEEEEeCCCC----CCCCcEEEEcC
Confidence            6  33445555555432    24688888865


No 3  
>PF00553 CBM_2:  Cellulose binding domain;  InterPro: IPR001919 The microbial degradation of cellulose and xylans requires several types of enzyme such as endoglucanases (3.2.1.4 from EC), cellobiohydrolases (3.2.1.91 from EC) (exoglucanases), or xylanases (3.2.1.8 from EC) []. Structurally, cellulases and xylanases generally consist of a catalytic domain joined to a cellulose-binding domain (CBD) by a short linker sequence rich in proline and/or hydroxy-amino acids. The CBD domain is found either at the N-terminal or at the C-terminal extremity of these enzymes. As it is shown in the following schematic representation, there are two conserved cysteines in this CBD domain - one at each extremity of the domain - which have been shown [] to be involved in a disulphide bond. There are also four conserved tryptophan, two are involved in cellulose binding. The CBD of a number of bacterial cellulases has been shown to consist of about 105 amino acid residues [, ].  +-------------------------------------------------+ | | xCxxxxWxxxxxNxxxWxxxxxxxWxxxxxxxxWNxxxxxGxxxxxxxxxxCx 'C': conserved cysteine involved in a disulphide bond. ; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0030246 carbohydrate binding, 0005975 carbohydrate metabolic process; PDB: 2CZN_A 2CWR_A 1HEH_C 1HEJ_C 3NDZ_E 3NDY_E 2XBD_A 1E5C_A 1XBD_A 1E5B_A ....
Probab=84.43  E-value=5.8  Score=32.53  Aligned_cols=99  Identities=20%  Similarity=0.297  Sum_probs=61.8

Q ss_pred             EeEEEeeccccceEEEEEEEeccCCcCccceeEEeecCCCCCcceEEEecceeCCCCCCCCccEEEEeccchhHHHhhhC
Q 040362          203 VHWHVKANYKKHWLAKITITNFNNQRDFTQWTLVFQHPNLKNVTKVYRFLYKPLNFYQPLNDTGMFYGIKYYNDLLMEAG  282 (356)
Q Consensus       203 IhWHVk~nYk~~W~vkiTi~N~~~~~ny~dW~~vvqhpn~~~~~~vySFN~t~l~~y~~~N~T~m~~Gl~~yN~ll~~~g  282 (356)
                      +-.-|..+.-+++.++|+|+|=.. ....+|.+-++.|.-.-+++++  |++.-.    ..+++.+-+. .||-.|.   
T Consensus         3 v~~~v~~~W~~Gf~~~v~v~N~~~-~~i~~W~v~~~~~~~~~i~~~W--na~~s~----~g~~~~v~~~-~wn~~i~---   71 (101)
T PF00553_consen    3 VTYTVTNSWGGGFQGEVTVTNNGS-SPINGWTVTFTFPSGQTITSSW--NATVSQ----SGNTVTVTNP-SWNGTIA---   71 (101)
T ss_dssp             EEEEEEEESSSEEEEEEEEEESSS-STEESEEEEEEESTTEEEEEEE--SCEEEE----ETTEEEEEES-STCSEEE---
T ss_pred             EEEEEecccCCCeEEEEEEEECCC-CccCCEEEEEEeCCCCEEeeee--ccEEEe----cCCEEEEEcC-CcCcccC---
Confidence            455677889999999999999663 6777999999998644455554  444211    1245666654 3443332   


Q ss_pred             CCCceeEEEEEeecCCCcccccCCCCceeeEEcCCcc
Q 040362          283 PYGYLQSELILGKDKNTFTLEKGRAFPSKVYVNGDEC  319 (356)
Q Consensus       283 ~~G~vQSeilf~Kd~~~ft~~~GwaFP~rVyFNGdeC  319 (356)
                       +|.- ..+-|.=..     ....+-|..+-|||..|
T Consensus        72 -~G~s-~~~Gf~~~~-----~~~~~~p~~~t~ng~~C  101 (101)
T PF00553_consen   72 -PGGS-VTFGFQASG-----SGSSAAPSTCTVNGAPC  101 (101)
T ss_dssp             -ESEE-EEEEEEEEE-----SSS--SESEEEETTEEE
T ss_pred             -CCCe-EEEEEEEeC-----CCCCCCCcEEEEcCeeC
Confidence             2322 234444331     22334599999999998


No 4  
>smart00637 CBD_II CBD_II domain.
Probab=79.56  E-value=5  Score=32.01  Aligned_cols=46  Identities=26%  Similarity=0.493  Sum_probs=35.6

Q ss_pred             ccCCceEEEEEEecCccccccCCCCCeeeeeecCCeeEEeeccceEeecC
Q 040362            3 WTADGYVALVTINNIQMYRSIMTPGWTLGWMWAKKEVIWSIVGAQATDQG   52 (356)
Q Consensus         3 wt~~~Y~A~VTi~N~q~~r~i~~pgW~L~W~W~~~E~IwsM~GA~~t~qg   52 (356)
                      |. +||.+.|+|.|..-. .|+  +|.|.|+-..++-|-++..|..+..|
T Consensus         4 W~-~G~~~~v~vtN~~~~-~~~--~W~v~~~~~~~~~i~~~Wn~~~~~~g   49 (92)
T smart00637        4 WG-SGFTANVTVTNTGSS-AIN--GWTVTFDLPGGQTVTNSWNATVSQSG   49 (92)
T ss_pred             CC-CCEEEEEEEEeCCCC-ccc--CeEEEEEcCCCcEEeeeEEEEEEecC
Confidence            54 489999999997543 354  99999999888878788777766543


No 5  
>PF03128 CXCXC:  CXCXC repeat;  InterPro: IPR004153 This repeat contains the conserved pattern CXCXC where X can be any amino acid. The repeat is found in up to five copies in Vascular endothelial growth factor C []. In the salivary glands of the dipteran Chironomus tentans, a specific messenger ribonucleoprotein (mRNP) particle, the Balbiani ring (BR) granule, can be visualized during its assembly on the gene and during its nucleocytoplasmic transport. This repeat is found over 70 copies in the balbiani ring protein 3 (Q03376 from SWISSPROT). It is also found in some silk proteins [].
Probab=54.98  E-value=6.1  Score=22.79  Aligned_cols=8  Identities=38%  Similarity=1.377  Sum_probs=6.3

Q ss_pred             CCCCcCCC
Q 040362          180 PSCSCGCG  187 (356)
Q Consensus       180 ~tCaCGC~  187 (356)
                      .||+|+|+
T Consensus         7 ~tC~C~Cp   14 (14)
T PF03128_consen    7 DTCQCECP   14 (14)
T ss_pred             CCcCccCC
Confidence            47999985


No 6  
>PF10563 CdCA1:  Cadmium carbonic anhydrase repeat;  InterPro: IPR018883  This entry represents the cadmium-binding carbonic anhydrase domain of marine diatoms []. The prevalence of carbonic anhydrase in diatoms that contain Cd at their active site probably reflects the very low concentration of Zn in the marine environment and the difficulty in acquiring inorganic carbon for photosynthesis. Compared with alpha- and gamma-carbonic anhydrases that use three histidines to coordinate the zinc-atom, this beta-carbonic anhydrase has two cysteines and one histidine, and rapidly binds cadmium []. ; PDB: 3BOH_A 3BOJ_A 3BOC_A 3BOE_A 3BOB_A.
Probab=47.12  E-value=3.8  Score=39.41  Aligned_cols=14  Identities=50%  Similarity=1.341  Sum_probs=7.4

Q ss_pred             CCcceEEeEEEeec
Q 040362          197 NTCPIRVHWHVKAN  210 (356)
Q Consensus       197 ~mCpV~IhWHVk~n  210 (356)
                      .||||+||||+-.-
T Consensus         5 ~mc~vnvhwHlgaE   18 (218)
T PF10563_consen    5 SMCPVNVHWHLGAE   18 (218)
T ss_dssp             EEEECGGG------
T ss_pred             eeeeeeeecccccc
Confidence            59999999999873


No 7  
>smart00141 PDGF Platelet-derived and vascular endothelial growth factors (PDGF, VEGF) family. Platelet-derived growth factor is a potent activator for cells of  mesenchymal origin. PDGF-A and PDGF-B form AA and BB homodimers and an AB heterodimer. Members of the VEGF family are homologues of PDGF.
Probab=46.22  E-value=31  Score=28.38  Aligned_cols=21  Identities=24%  Similarity=0.521  Sum_probs=17.5

Q ss_pred             cccCCCeEEeCCCCCCCCcee
Q 040362           64 CCRRNPVIVDLLPGVPMNQQF   84 (356)
Q Consensus        64 ~C~k~P~IvDL~P~~~~d~qi   84 (356)
                      .|+.|++||||.++-|.+...
T Consensus         2 ~C~pre~~V~i~~e~~~~~~~   22 (83)
T smart00141        2 ECKPREVVVEVSREYPDETNF   22 (83)
T ss_pred             CCceeeEEEECchhcCCccCc
Confidence            599999999999988776543


No 8  
>PF11403 Yeast_MT:  Yeast metallothionein;  InterPro: IPR022710  Metallothioneins are characterised by an abundance of cysteine residues and a lack of generic secondary structure motifs. This protein functions in primary metal storage, transport and detoxification []. For the first 40 residues in the protein the polypeptide wraps around the metal by forming two large parallel loops separated by a deep cleft containing the metal cluster []. ; PDB: 1AQS_A 1AQR_A 1RJU_V 1FMY_A 1AOO_A 1AQQ_A.
Probab=36.83  E-value=26  Score=25.33  Aligned_cols=8  Identities=63%  Similarity=1.867  Sum_probs=3.4

Q ss_pred             CCcC-CCCC
Q 040362          182 CSCG-CGNE  189 (356)
Q Consensus       182 CaCG-C~~~  189 (356)
                      |.|| |.++
T Consensus         9 cqcgscknn   17 (40)
T PF11403_consen    9 CQCGSCKNN   17 (40)
T ss_dssp             -SSSTTTT-
T ss_pred             eecCCccCh
Confidence            5555 5555


No 9  
>COG5341 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.03  E-value=44  Score=30.08  Aligned_cols=39  Identities=26%  Similarity=0.361  Sum_probs=33.9

Q ss_pred             CCCceeEEEEEeecCCCcccccCCCCceeeEEcCCcccC
Q 040362          283 PYGYLQSELILGKDKNTFTLEKGRAFPSKVYVNGDECMM  321 (356)
Q Consensus       283 ~~G~vQSeilf~Kd~~~ft~~~GwaFP~rVyFNGdeC~m  321 (356)
                      -.|++=-++.++|...+|++++-+||=-+|-|.|+|=+.
T Consensus        45 v~Gk~~r~i~l~Kg~~t~~v~~~~g~~n~vev~g~~IRV   83 (132)
T COG5341          45 VDGKVIRTIPLTKGNETFDVKENGGFYNKVEVKGNRIRV   83 (132)
T ss_pred             ECCEEEEEEEcccCCccEEEEcCCCceEEEEEcCCEEEE
Confidence            368888888899888999999999999999999987543


No 10 
>PF10609 ParA:  ParA/MinD ATPase like;  InterPro: IPR019591  This entry represents ATPases involved in plasmid partitioning []. It also contains cytosolic Fe-S cluster assembling factors, NBP35 and CFD1 which are required for biogenesis and export of both ribosomal subunits probably through assembling the ISCs in RLI1, a protein which performs rRNA processing and ribosome export [, , ].; PDB: 2PH1_A 3KB1_B.
Probab=30.22  E-value=27  Score=28.73  Aligned_cols=15  Identities=33%  Similarity=0.722  Sum_probs=9.2

Q ss_pred             eEEeCCCCCCCCceee
Q 040362           70 VIVDLLPGVPMNQQFI   85 (356)
Q Consensus        70 ~IvDL~P~~~~d~qi~   85 (356)
                      .|||||||+ -|.++.
T Consensus         4 LiiD~PPGT-gD~~l~   18 (81)
T PF10609_consen    4 LIIDLPPGT-GDEHLT   18 (81)
T ss_dssp             EEEE--SCS-SSHHHH
T ss_pred             EEEeCCCCC-CcHHHH
Confidence            589999999 454544


No 11 
>cd00135 PDGF Platelet-derived and vascular endothelial growth factors (PDGF, VEGF) family domain; PDGF is a potent activator for cells of mesenchymal origin; PDGF-A and PDGF-B form AA and BB homodimers and an AB heterodimer; VEGF is a potent mitogen in embryonic and somatic angiogenesis with a unique specificity for vascular endothelial cells; VEGF forms homodimers and exists in 4 different isoforms; overall, the VEGF monomer resembles that of PDGF, but its N-terminal segment is helical rather than extended; the cysteine knot motif is a common feature of this domain
Probab=29.96  E-value=1e+02  Score=25.31  Aligned_cols=18  Identities=17%  Similarity=0.534  Sum_probs=16.2

Q ss_pred             cccCCCeEEeCCCCCCCC
Q 040362           64 CCRRNPVIVDLLPGVPMN   81 (356)
Q Consensus        64 ~C~k~P~IvDL~P~~~~d   81 (356)
                      .|+.++++|||.++-+.+
T Consensus         2 ~C~Pr~~~V~i~~e~~~~   19 (86)
T cd00135           2 SCKPRETLVEISEELPDE   19 (86)
T ss_pred             ccccccEEEECcccCCCC
Confidence            599999999999998875


No 12 
>PF02718 Herpes_UL31:  Herpesvirus UL31-like protein;  InterPro: IPR021152 This is a family of Herpesvirus proteins, belong to the UL31 family, which including UL31, UL53, and the product of ORF69 in some strains. The proteins in this family have no known function.
Probab=23.36  E-value=55  Score=32.29  Aligned_cols=29  Identities=38%  Similarity=0.681  Sum_probs=22.1

Q ss_pred             cCCCCcceEEeccccCCCcc--cCCCC-CcCC
Q 040362          158 ASKNPKCCVSLSSFYNPMIT--PCPSC-SCGC  186 (356)
Q Consensus       158 ~~k~P~CCVSfSsfYN~siv--pC~tC-aCGC  186 (356)
                      .+-.|-.|.|||+|=|+.+.  -|++| +=|.
T Consensus        65 ~~~~p~~CL~LSp~G~~~~~g~~C~~C~~~~~   96 (258)
T PF02718_consen   65 SSHAPGRCLSLSPMGYSLGMGGCCPTCTSSGE   96 (258)
T ss_pred             cccCCCCceeccCCcccCccCccCCCCCCCCC
Confidence            34578999999999998876  48877 4444


No 13 
>PHA02661 vascular endothelial growth factor like protein; Provisional
Probab=23.21  E-value=1.1e+02  Score=27.94  Aligned_cols=25  Identities=20%  Similarity=0.210  Sum_probs=20.2

Q ss_pred             ccccccCCCeEEeCCCCCCCCceee
Q 040362           61 IPHCCRRNPVIVDLLPGVPMNQQFI   85 (356)
Q Consensus        61 ~p~~C~k~P~IvDL~P~~~~d~qi~   85 (356)
                      ....|+.|+++|||..+-|.+...-
T Consensus        44 ~~s~CkPRetvV~I~~E~p~~~n~~   68 (146)
T PHA02661         44 DKSSCQPRDTVVQLSDEYPGNTNDR   68 (146)
T ss_pred             hccCceeeeEEEECccccCccccce
Confidence            4668999999999999887765433


Done!