Citrus Sinensis ID: 040374


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MAMALKHAFFILALTCLIMANIANATSRNDHLNNNMKLGYNLATRLEASGSLTECWNALMELKSCSNEIIIFFLNGQADIGPDCCRAIDIITRNCWPTMLTSLGFTAEEGNILRGYCDASSAPSPGGPAVIYQPQTDNI
cccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHccccccHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHccccccccHHHHHHccccccccccccccccccccccccc
****LKHAFFILALTCLIMANIANATS**************LA****ASGSLTECWNALMELKSCSNEIIIFFLNGQADIGPDCCRAIDIITRNCWPTMLTSLGFTAEEGNILRGYCD*********************
xxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMALKHAFFILALTCLIMANIANATSRNDHLNNNMKLGYNLATRLEASGSLTECWNALMELKSCSNEIIIFFLNGQADIGPDCCRAIDIITRNCWPTMLTSLGFTAEEGNILRGYCDASSAPSPGGPAVIYQPQTDNI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Egg cell-secreted protein 1.4 Involved in the regulation of gamete interactions during the double fertilization and to prevent multiple-pollen tube attraction; mediates the redistribution of the gamete fusogen HAP2/GCS1 to the cell surface after secretion upon sperm arrival.probableQ9T039

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted