Citrus Sinensis ID: 040434

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MDRLDGSARLMIVSDLDLTMVDHDDGENLSLLRFNALWEAHYRQDSLLVFSTGRSPTIYKQLRKEKPLLTPDITIMSVGTEIVYGESMVHDDGWENYLNHKWDRGIVLEETAKFPELAFQVCLFFSKWMVLMEQEVLSSDH
cccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHccccCEEEEECcccHHHHHHHHHHcccccccEEEEcccEEEEEcccccccHHHHHHHHccccHHHHHHHHHccccccccccccccccEEEEEEEEccccc
******S**LMIVSDLDLTMVDHDDGENLSLLRFNALWEAHYRQDSLLVFSTGRSPTIYKQLRKEKPLLTPDITIMSVGTEIVYGESMVHDDGWENYLNHKWDRGIVLEETAKFPELAFQVCLFFSKWMVLMEQE******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRLDGSARLMIVSDLDLTMVDHDDGENLSLLRFNALWEAHYRQDSLLVFSTGRSPTIYKQLRKEKPLLTPDITIMSVGTEIVYGESMVHDDGWENYLNHKWDRGIVLEETAKFPELAFQVCLFFSKWMVLMEQEVLSSDH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable sucrose-phosphatase 1 Catalyzes the final step of sucrose synthesis.probableQ94E75
Probable sucrose-phosphatase 2 Catalyzes the final step of sucrose synthesis.probableQ9SJ66

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S2O, chain A
Confidence level:very confident
Coverage over the Query: 9-120
View the alignment between query and template
View the model in PyMOL