BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 040446
(270 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3MRZ|S Chain S, Recognition Of The Amber Stop Codon By Release Factor Rf1.
This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s
Ribosomal Subunit Can Be Found In Pdb Entry 3ms0.
Molecule A In The Same Asymmetric Unit Is Deposited As
3mr8 (50s) And 3ms1 (30s).
pdb|3MS1|S Chain S, Recognition Of The Amber Stop Codon By Release Factor Rf1.
This Entry 3ms1 Contains 50s Ribosomal Subunit. The 30s
Ribosomal Subunit Can Be Found In Pdb Entry 3mr8.
Molecule B In The Same Asymmetric Unit Is Deposited As
3mrz (50s) And 3ms0 (30s).
pdb|3PYO|S Chain S, Crystal Structure Of A Complex Containing Domain 3 From
The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
File Contains The 50s Subunit Of The First 70s Ribosome.
pdb|3PYR|S Chain S, Crystal Structure Of A Complex Containing Domain 3 From
The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
File Contains The 50s Subunit Of The Second 70s
Ribosome.
pdb|3PYT|S Chain S, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
Igr Ires Rna Bound To The 70s Ribosome. This File
Contains The 50s Subunit Of The First 70s Ribosome.
pdb|3PYV|S Chain S, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
Igr Ires Rna Bound To The 70s Ribosome. This File
Contains The 50s Subunit Of The Second 70s Ribosome
Length = 112
Score = 67.8 bits (164), Expect = 5e-12, Method: Compositional matrix adjust.
Identities = 41/106 (38%), Positives = 65/106 (61%)
Query: 111 QAVLKGIKQSPKKINLVAALVRGMRVEDALLQLQVTIKRAAKTVYQVIHSARANATHNHG 170
+A+ + ++ SP+K+ LV L+RG +E+A L+ T KR A V +V+ SA ANA +NH
Sbjct: 4 KAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHD 63
Query: 171 LDPDRLLVAEAFVGKGFFKKRVSYHSKGRSGIKVRPECRLTVVVRE 216
+ DRL V A+V +G KRV ++GR+ I + +TV++ E
Sbjct: 64 MLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGE 109
>pdb|1JZX|L Chain L, Structural Basis For The Interaction Of Antibiotics With
The Peptidyl Transferase Center In Eubacteria
pdb|1JZY|L Chain L, Structural Basis For The Interaction Of Antibiotics With
The Peptidyl Transferase Center In Eubacteria
pdb|1JZZ|L Chain L, Structural Basis For The Interaction Of Antibiotics With
The Peptidyl Transferase Center In Eubacteria
pdb|1K01|L Chain L, Structural Basis For The Interaction Of Antibiotics With
The Peptidyl Transferase Center In Eubacteria
pdb|1J5A|L Chain L, Structural Basis For The Interaction Of Antibiotics With
The Peptidyl Transferase Center In Eubacteria
pdb|1NKW|Q Chain Q, Crystal Structure Of The Large Ribosomal Subunit From
Deinococcus Radiodurans
pdb|1NWX|Q Chain Q, Complex Of The Large Ribosomal Subunit From Deinococcus
Radiodurans With Abt-773
pdb|1NWY|Q Chain Q, Complex Of The Large Ribosomal Subunit From Deinococcus
Radiodurans With Azithromycin
pdb|1OND|Q Chain Q, The Crystal Structure Of The 50s Large Ribosomal Subunit
From Deinococcus Radiodurans Complexed With
Troleandomycin Macrolide Antibiotic
pdb|1SM1|Q Chain Q, Complex Of The Large Ribosomal Subunit From Deinococcus
Radiodurans With Quinupristin And Dalfopristin
pdb|1XBP|Q Chain Q, Inhibition Of Peptide Bond Formation By Pleuromutilins:
The Structure Of The 50s Ribosomal Subunit From
Deinococcus Radiodurans In Complex With Tiamulin
pdb|2ZJP|P Chain P, Thiopeptide Antibiotic Nosiheptide Bound To The Large
Ribosomal Subunit Of Deinococcus Radiodurans
pdb|2ZJQ|P Chain P, Interaction Of L7 With L11 Induced By Microccocin Binding
To The Deinococcus Radiodurans 50s Subunit
pdb|2ZJR|P Chain P, Refined Native Structure Of The Large Ribosomal Subunit
(50s) From Deinococcus Radiodurans
pdb|3CF5|P Chain P, Thiopeptide Antibiotic Thiostrepton Bound To The Large
Ribosomal Subunit Of Deinococcus Radiodurans
pdb|3DLL|P Chain P, The Oxazolidinone Antibiotics Perturb The Ribosomal
Peptidyl-Transferase Center And Effect Trna Positioning
pdb|3PIO|P Chain P, Crystal Structure Of The Synergistic Antibiotic Pair
Lankamycin And Lankacidin In Complex With The Large
Ribosomal Subunit
pdb|3PIP|P Chain P, Crystal Structure Of The Synergistic Antibiotic Pair
Lankamycin And Lankacidin In Complex With The Large
Ribosomal Subunit
Length = 134
Score = 67.8 bits (164), Expect = 6e-12, Method: Compositional matrix adjust.
Identities = 39/105 (37%), Positives = 64/105 (60%)
Query: 112 AVLKGIKQSPKKINLVAALVRGMRVEDALLQLQVTIKRAAKTVYQVIHSARANATHNHGL 171
AV K ++ SP+K+ LV ++RG V+DA L+ + A++ V +V++SA+ANA HN +
Sbjct: 26 AVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLLRFIPRSASEPVAKVLNSAKANALHNDEM 85
Query: 172 DPDRLLVAEAFVGKGFFKKRVSYHSKGRSGIKVRPECRLTVVVRE 216
DRL V EA+V G KR+ ++G + I + +T++V E
Sbjct: 86 LEDRLFVKEAYVDAGPTLKRLIPRARGSANIIKKRTSHITIIVAE 130
>pdb|1GIY|S Chain S, Crystal Structure Of The Ribosome At 5.5 A Resolution.
This File, 1giy, Contains The 50s Ribosome Subunit. The
30s Ribosome Subunit, Three Trna, And Mrna Molecules Are
In The File 1gix
pdb|1ML5|SS Chain s, Structure Of The E. Coli Ribosomal Termination Complex
With Release Factor 2
pdb|1YL3|S Chain S, Crystal Structure Of 70s Ribosome With Thrs Operator And
Trnas. Large Subunit. The Coordinates For The Small
Subunit Are In The Pdb Entry 1yl4.
pdb|2B66|W Chain W, 50s Ribosomal Subunit From A Crystal Structure Of Release
Factor Rf1, Trnas And Mrna Bound To The Ribosome. This
File Contains The 50s Subunit From A Crystal Structure
Of Release Factor Rf1, Trnas And Mrna Bound To The
Ribosome And Is Described In Remark 400
pdb|2B9N|W Chain W, 50s Ribosomal Subunit From A Crystal Structure Of Release
Factor Rf2, Trnas And Mrna Bound To The Ribosome. This
File Contains The 50s Subunit From A Crystal Structure
Of Release Factor Rf1, Trnas And Mrna Bound To The
Ribosome And Is Described In Remark 400.
pdb|2B9P|W Chain W, 50s Ribosomal Subunit From A Crystal Structure Of The
Ribosome In Complex With Trnas And Mrna With A Stop
Codon In The A-Site. This File Contains The 50s Subunit
From A Crystal Structure Of The Ribosome In Complex With
Trnas And Mrna With A Stop Codon In The A-Site And Is
Described In Remark 400.
pdb|2J01|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4).
This File Contains The 50s Subunit From Molecule I.
pdb|2J03|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Mrna, Trna And Paromomycin (Part 4 Of 4).
This File Contains The 50s Subunit From Molecule Ii.
pdb|2HGJ|V Chain V, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
Showing How The 16s 3'-End Mimicks Mrna E And P Codons.
This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s
Ribosomal Subunit Can Be Found In Pdb Entry 2hgi.
pdb|2HGQ|V Chain V, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
With Translocated And Rotated Shine-Dalgarno Duplex.
This Entry 2hgq Contains 50s Ribosomal Subunit. The 30s
Ribosomal Subunit Can Be Found In Pdb Entry 2hgp.
pdb|2HGU|V Chain V, 70s T.Th. Ribosome Functional Complex With Mrna And E- And
P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s
Ribosomal Subunit. The 30s Ribosomal Subunit Can Be
Found In Pdb Entry 2hgr.
pdb|1VSA|Q Chain Q, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
Functional Interactions And Rearrangements. This File,
1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome
Subunit Is In The File 2ow8
pdb|2V47|W Chain W, Structure Of The Ribosome Recycling Factor Bound To The
Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
Trna-Fmet (Part 2 Of 4). This File Contains The 50s
Subunit For Molecule 1.
pdb|2V49|W Chain W, Structure Of The Ribosome Recycling Factor Bound To The
Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
Trna-Fmet (Part 4 Of 4). This File Contains The 50s
Subunit Of Molecule 2.
pdb|1VSP|Q Chain Q, Interactions And Dynamics Of The Shine-Dalgarno Helix In
The 70s Ribosome. This File, 1vsp, Contains The 50s
Ribosome Subunit. 30s Ribosome Subunit Is In The File
2qnh
pdb|3D5B|W Chain W, Structural Basis For Translation Termination On The 70s
Ribosome. This File Contains The 50s Subunit Of One 70s
Ribosome. The Entire Crystal Structure Contains Two 70s
Ribosomes As Described In Remark 400.
pdb|3D5D|W Chain W, Structural Basis For Translation Termination On The 70s
Ribosome. This File Contains The 50s Subunit Of The
Second 70s Ribosome. The Entire Crystal Structure
Contains Two 70s Ribosomes As Described In Remark 400.
pdb|3F1F|W Chain W, Crystal Structure Of A Translation Termination Complex
Formed With Release Factor Rf2. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes As Described In
Remark 400.
pdb|3F1H|W Chain W, Crystal Structure Of A Translation Termination Complex
Formed With Release Factor Rf2. This File Contains The
50s Subunit Of The Second 70s Ribosome. The Entire
Crystal Structure Contains Two 70s Ribosomes As
Described In Remark 400.
pdb|3FIN|W Chain W, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas
And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A
6.4 A Cryo-Em Map. This File Contains The 50s Subunit.
pdb|2WDI|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome In
Complex With Mrna, Paromomycin, Acylated A-Site Trna,
Deacylated P-Site Trna, And E-Site Trna. This File
Contains The 50s Subunit For Molecule I.
pdb|2WDJ|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome In
Complex With Mrna, Paromomycin, Acylated A-Site Trna,
Deacylated P-Site Trna, And E-Site Trna. This File
Contains The 50s Subunit For Molecule Ii.
pdb|2WDL|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome In
Complex With Mrna, Paromomycin, Acylated A- And P-Site
Trnas, And E-Site Trna. This File Contains The 50s
Subunit For Molecule I.
pdb|2WDN|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome In
Complex With Mrna, Paromomycin, Acylated A- And P-Site
Trnas, And E-Site Trna. This File Contains The 50s
Subunit For Molecule Ii.
pdb|2WH2|W Chain W, Insights Into Translational Termination From The Structure
Of Rf2 Bound To The Ribosome
pdb|2WH4|W Chain W, Insights Into Translational Termination From The Structure
Of Rf2 Bound To The Ribosome
pdb|3HUX|W Chain W, Structure Of Ef-P Bound To The 70s Ribosome; This File
Contains The 50s Subunit For Molecule I.
pdb|3HUZ|W Chain W, Structure Of Ef-P Bound To The 70s Ribosome; This File
Contains The 50s Subunit For Molecule Ii.
pdb|2WRJ|W Chain W, The Structure Of The Ribosome With Elongation Factor G
Trapped In The Post-Translocational State (Part 2 Of 4).
pdb|2WRL|W Chain W, The Structure Of The Ribosome With Elongation Factor G
Trapped In The Post-Translocational State. (Part 4 Of
4).
pdb|2WRO|W Chain W, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
And Trna (Part 2 Of 4).
pdb|2WRR|W Chain W, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
And Trna (Part 4 Of 4).
pdb|3KIR|W Chain W, Structure Of Rele Nuclease Bound To The 70s Ribosome
(Precleavage State; Part 2 Of 4)
pdb|3KIT|W Chain W, Structure Of Rele Nuclease Bound To The 70s Ribosome
(Precleavage State; Part 4 Of 4)
pdb|3KIW|W Chain W, Structure Of Rele Nuclease Bound To The 70s Ribosome
(Postcleavage State; Part 2 Of 4)
pdb|3KIY|W Chain W, Structure Of Rele Nuclease Bound To The 70s Ribosome
(Postcleavage State; Part 4 Of 4)
pdb|3KNI|W Chain W, The Structures Of Viomycin Bound To The 70s Ribosome. This
File Contains The 50s Subunit For Molecule I
pdb|3KNK|W Chain W, The Structures Of Viomycin Bound To The 70s Ribosome. This
File Contains The 50s Subunit For Molecule Ii.
pdb|3KNM|W Chain W, The Structures Of Capreomycin Bound To The 70s Ribosome.
Thi Contains The 50s Subunit For Molecule I.
pdb|3KNO|W Chain W, The Structures Of Capreomycin Bound To The 70s Ribosome.
Thi Contains The 50s Subunit For Molecule Ii
pdb|3I8F|S Chain S, Elongation Complex Of The 70s Ribosome With Three Trnas
And Entry 3i8f Contains 50s Ribosomal Subunit. The 30s
Ribosoma Can Be Found In Pdb Entry 3i8g. Molecule B In
The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
(50s).
pdb|3I8I|S Chain S, Elongation Complex Of The 70s Ribosome With Three Trnas
And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s
Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In
The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
(30s).
pdb|3I9C|S Chain S, Initiation Complex Of 70s Ribosome With Two Trnas And
Mrna. 3i9c Contains 50s Ribosomal Subunit Of Molecule B.
The 30s Subunit Can Be Found In Pdb Entry 3i9b. Molecule
A In The S Asymmetric Unit Is Deposited As 3i9d (30s)
And 3i9e (50s)
pdb|3I9E|S Chain S, Initiation Complex Of 70s Ribosome With Two Trnas And
Mrna. 3i9e Contains 50s Ribosomal Subunit Of Molecule A.
The 30s Subunit Can Be Found In Pdb Entry 3i9d. Molecule
B In The S Asymmetric Unit Is Deposited As 3i9b (30s)
And 3i9c (50s)
pdb|2X9S|W Chain W, Structure Of The 70s Ribosome Bound To Release Factor 2
And A Substrate Analog Provides Insights Into Catalysis
Of Peptide Release
pdb|2X9U|W Chain W, Structure Of The 70s Ribosome Bound To Release Factor 2
And A Substrate Analog Provides Insights Into Catalysis
Of Peptide Release
pdb|2XG0|W Chain W, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
70s Ribosome (Part 2 Of 4)
pdb|2XG2|W Chain W, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
70s Ribosome (Part 4 Of 4)
pdb|3OH5|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Chloramphenicol. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3OH7|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Chloramphenicol. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3OHJ|W Chain W, Structure Of The Thermus Thermophilus Ribosome Complexed
With Erythromycin. This File Contains The 50s Subunit Of
One 70s Ribosome. The Entire Crystal Structure Contains
Two 70s Ribosomes.
pdb|3OHK|W Chain W, Structure Of The Thermus Thermophilus Ribosome Complexed
With Erythromycin. This File Contains The 50s Subunit Of
One 70s Ribosome. The Entire Crystal Structure Contains
Two 70s Ribosomes.
pdb|3OHZ|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Azithromycin. This File Contains The 50s
Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3OI1|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Azithromycin. This File Contains The 50s
Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3OI3|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Telithromycin. This File Contains The 50s
Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3OI5|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Telithromycin. This File Contains The 50s
Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|2XQE|W Chain W, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The 70s
Ribosome With A Gtp Analog
pdb|2XTG|W Chain W, Trna Tranlocation On The 70s Ribosome: The Pre-
Translocational Translocation Intermediate Ti(Pre)
pdb|2XUX|W Chain W, Trna Translocation On The 70s Ribosome: The Post-
Translocational Translocation Intermediate Ti(Post)
pdb|2Y0V|W Chain W, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
Near-Cognate Codon On The 70s Ribosome
pdb|2Y0X|W Chain W, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
Near-Cognate Codon On The 70s Ribosome
pdb|2Y0Z|W Chain W, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
A Near-Cognate Codon On The 70s Ribosome
pdb|2Y11|W Chain W, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
Cognate Codon On The 70s Ribosome.
pdb|2Y13|W Chain W, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
A Near-Cognate Codon On The 70s Ribosome
pdb|2Y15|W Chain W, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
A Cognate Codon On The 70s Ribosome.
pdb|2Y17|W Chain W, Ef-Tu Complex 3
pdb|2Y19|W Chain W, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
Cognate Codon On The 70s Ribosome.
pdb|3ZVP|W Chain W, Crystal Structure Of The Hybrid State Of Ribosome In
Complex With The Guanosine Triphosphatase Release Factor
3
pdb|3UXQ|W Chain W, The Structure Of Thermorubin In Complex With The 70s
Ribosome From Thermus Thermophilus. This File Contains
The 50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3UXR|W Chain W, The Structure Of Thermorubin In Complex With The 70s
Ribosome From Thermus Thermophilus. This File Contains
The 50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3TVE|S Chain S, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Cognate
Trna-Leu Complex
pdb|3TVH|S Chain S, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The Cognate
Trna-Leu Complex
pdb|3UYE|S Chain S, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Leu Complex
pdb|3UYG|S Chain S, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Leu Complex
pdb|3UZ1|S Chain S, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Leu Complex With Paromomycin
pdb|3UZ2|S Chain S, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Leu Complex With Paromomycin.
pdb|3UZ8|S Chain S, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The Cognate
Trna-Tyr Complex.
pdb|3UZ9|S Chain S, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Cognate
Trna-Tyr Complex.
pdb|3UZF|S Chain S, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Tyr Complex
pdb|3UZH|S Chain S, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Tyr Complex.
pdb|3UZK|S Chain S, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Tyr Complex With Paromomycin
pdb|3UZN|S Chain S, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The Near-cognate
Trna-tyr Complex With Paromomycin
pdb|4ABS|W Chain W, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin
With The 70s Ribosome
pdb|4DHA|W Chain W, Crystal Structure Of Yaej Bound To The 70s Ribosome
pdb|4DHC|W Chain W, Crystal Structure Of Yaej Bound To The 70s Ribosome
pdb|3V23|W Chain W, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 50s Subunit Of
The 1st Ribosome In The Asu
pdb|3V25|W Chain W, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 50s Subunit Of
The 2nd Ribosome In The Asu
pdb|3V27|W Chain W, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 50s Subunit Of
The 1st Ribosome In The Asu
pdb|3V29|W Chain W, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
Entry Contains The 50s Subunit Of The 2nd Molecule In
The Asu.
pdb|3V2D|W Chain W, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 50s Subunit Of
The 1st Ribosome In The Asu
pdb|3V2F|W Chain W, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 50s Subunit Of
The 2nd Ribosome In The Asu
pdb|4G5L|S Chain S, Crystal Structure Of The 70s Ribosome With Tetracycline.
This Entry Contains The 50s Subunit Of Molecule A.
pdb|4G5N|S Chain S, Crystal Structure Of The 70s Ribosome With Tetracycline.
This Entry Contains The 50s Subunit Of Molecule B.
pdb|4G5U|S Chain S, Crystal Structure Of The 70s Ribosome With Tigecycline.
This Entry Contains The 50s Subunit Of Molecule A.
pdb|4G5W|S Chain S, Crystal Structure Of The 70s Ribosome With Tigecycline.
This Entry Contains The 50s Subunit Of Molecule B
Length = 113
Score = 67.8 bits (164), Expect = 6e-12, Method: Compositional matrix adjust.
Identities = 41/106 (38%), Positives = 65/106 (61%)
Query: 111 QAVLKGIKQSPKKINLVAALVRGMRVEDALLQLQVTIKRAAKTVYQVIHSARANATHNHG 170
+A+ + ++ SP+K+ LV L+RG +E+A L+ T KR A V +V+ SA ANA +NH
Sbjct: 4 KAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHD 63
Query: 171 LDPDRLLVAEAFVGKGFFKKRVSYHSKGRSGIKVRPECRLTVVVRE 216
+ DRL V A+V +G KRV ++GR+ I + +TV++ E
Sbjct: 64 MLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGE 109
>pdb|1PNU|Q Chain Q, Crystal Structure Of A Streptomycin Dependent Ribosome
From Escherichia Coli, 50s Subunit Of 70s Ribosome. This
File, 1pnu, Contains Only Molecules Of The 50s Ribosomal
Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site
Trna Are In The Pdb File 1pns.
pdb|1PNY|Q Chain Q, Crystal Structure Of The Wild Type Ribosome From E. Coli,
50s Subunit Of 70s Ribosome. This File, 1pny, Contains
Only Molecules Of The 50s Ribosomal Subunit. The 30s
Subunit Is In The Pdb File 1pnx.
pdb|1VOR|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|1VOU|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|1VOW|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|1VOY|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|1VP0|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400
Length = 130
Score = 67.8 bits (164), Expect = 6e-12, Method: Compositional matrix adjust.
Identities = 39/105 (37%), Positives = 64/105 (60%)
Query: 112 AVLKGIKQSPKKINLVAALVRGMRVEDALLQLQVTIKRAAKTVYQVIHSARANATHNHGL 171
AV K ++ SP+K+ LV ++RG V+DA L+ + A++ V +V++SA+ANA HN +
Sbjct: 22 AVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLLRFIPRSASEPVAKVLNSAKANALHNDEM 81
Query: 172 DPDRLLVAEAFVGKGFFKKRVSYHSKGRSGIKVRPECRLTVVVRE 216
DRL V EA+V G KR+ ++G + I + +T++V E
Sbjct: 82 LEDRLFVKEAYVDAGPTLKRLIPRARGSANIIKKRTSHITIIVAE 126
>pdb|3SGF|W Chain W, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
State On A Rotated Conformation Of The Ribosome
Length = 116
Score = 67.0 bits (162), Expect = 9e-12, Method: Compositional matrix adjust.
Identities = 42/99 (42%), Positives = 59/99 (59%)
Query: 118 KQSPKKINLVAALVRGMRVEDALLQLQVTIKRAAKTVYQVIHSARANATHNHGLDPDRLL 177
+ S +K+ LVA L+RG +V AL L T K+AA V +V+ SA ANA HN G D D L
Sbjct: 11 RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70
Query: 178 VAEAFVGKGFFKKRVSYHSKGRSGIKVRPECRLTVVVRE 216
V + FV +G KR+ +KGR+ ++ +TVVV +
Sbjct: 71 VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109
>pdb|1P85|Q Chain Q, Real Space Refined Coordinates Of The 50s Subunit Fitted
Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
State Of E. Coli 70s Ribosome
pdb|1P86|Q Chain Q, Real Space Refined Coordinates Of The 50s Subunit Fitted
Into The Low Resolution Cryo-Em Map Of The
Initiation-Like State Of E. Coli 70s Ribosome
pdb|2AW4|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli At 3.5 A Resolution. This File Contains
The 50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2AWB|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli At 3.5 A Resolution. This File Contains
The 50s Subunit Of The Second 70s Ribosome. The Entire
Crystal Structure Contains Two 70s Ribosomes And Is
Described In Remark 400.
pdb|1VS6|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With The Antibiotic
Kasugamyin At 3.5a Resolution. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|1VS8|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With The Antibiotic
Kasugamyin At 3.5a Resolution. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2I2T|S Chain S, Crystal Structure Of Ribosome With Messenger Rna And The
Anticodon Stem-Loop Of P-Site Trna. This File Contains
The 50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2I2V|S Chain S, Crystal Structure Of Ribosome With Messenger Rna And The
Anticodon Stem-Loop Of P-Site Trna. This File Contains
The 50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2J28|S Chain S, Model Of E. Coli Srp Bound To 70s Rncs
pdb|2QOV|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin. This
File Contains The 50s Subunit Of The First 70s Ribosome.
The Entire Crystal Structure Contains Two 70s Ribosomes.
pdb|2QOX|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin. This
File Contains The 50s Subunit Of The Second 70s
Ribosome. The Entire Crystal Structure Contains Two 70s
Ribosomes.
pdb|2QOZ|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin And
Neomycin. This File Contains The 50s Subunit Of The
First 70s Ribosome, With Neomycin Bound. The Entire
Crystal Structure Contains Two 70s Ribosomes.
pdb|2QP1|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin And
Neomycin. This File Contains The 50s Subunit Of The
Second 70s Ribosome, With Neomycin Bound. The Entire
Crystal Structure Contains Two 70s Ribosomes.
pdb|2QAM|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Neomycin. This File
Contains The 50s Subunit Of The First 70s Ribosome, With
Neomycin Bound. The Entire Crystal Structure Contains
Two 70s Ribosomes And Is Described In Remark 400.
pdb|2QAO|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Neomycin. This File
Contains The 50s Subunit Of The Second 70s Ribosome,
With Neomycin Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes And Is Described In Remark
400.
pdb|2QBA|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin. This File
Contains The 50s Subunit Of The First 70s Ribosome, With
Gentamicin Bound. The Entire Crystal Structure Contains
Two 70s Ribosomes And Is Described In Remark 400.
pdb|2QBC|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin. This File
Contains The 50s Subunit Of The Second 70s Ribosome,
With Gentamicin Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes And Is Described In Remark
400.
pdb|2QBE|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Ribosome Recycling
Factor (Rrf). This File Contains The 50s Subunit Of The
First 70s Ribosome, With Rrf Bound. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2QBG|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Ribosome Recycling
Factor (Rrf). This File Contains The 50s Subunit Of The
Second 70s Ribosome, With Rrf Bound. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2QBI|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin And Ribosome
Recycling Factor (Rrf). This File Contains The 50s
Subunit Of The First 70s Ribosome, With Gentamicin And
Rrf Bound. The Entire Crystal Structure Contains Two 70s
Ribosomes And Is Described In Remark 400.
pdb|2QBK|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin And Ribosome
Recycling Factor (Rrf). This File Contains The 50s
Subunit Of The Second 70s Ribosome, With Gentamicin And
Rrf Bound. The Entire Crystal Structure Contains Two 70s
Ribosomes And Is Described In Remark 400.
pdb|2Z4L|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Paromomycin And
Ribosome Recycling Factor (Rrf). This File Contains The
50s Subunit Of The First 70s Ribosome, With Paromomycin
And Rrf Bound. The Entire Crystal Structure Contains Two
70s Ribosomes And Is Described In Remark 400.
pdb|2Z4N|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Paromomycin And
Ribosome Recycling Factor (Rrf). This File Contains The
50s Subunit Of The Second 70s Ribosome, With Paromomycin
And Rrf Bound. The Entire Crystal Structure Contains Two
70s Ribosomes And Is Described In Remark 400.
pdb|2VHM|S Chain S, Structure Of Pdf Binding Helix In Complex With The
Ribosome (Part 1 Of 4)
pdb|2VHN|S Chain S, Structure Of Pdf Binding Helix In Complex With The
Ribosome. (Part 2 Of 4)
pdb|2RDO|S Chain S, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound
pdb|3DF2|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Hygromycin B. This File
Contains The 50s Subunit Of The First 70s Ribosome. The
Entire Crystal Structure Contains Two 70s Ribosomes.
pdb|3DF4|S Chain S, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Hygromycin B. This File
Contains The 50s Subunit Of The Second 70s Ribosome. The
Entire Crystal Structure Contains Two 70s Ribosomes.
pdb|3BBX|S Chain S, The Hsp15 Protein Fitted Into The Low Resolution Cryo-Em
Map 50s.Nc-Trna.Hsp15 Complex
pdb|3FIK|S Chain S, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
Consists Of The 50s Subunit.
pdb|3E1B|L Chain L, Structure Of The 50s Subunit Of E. Coli Ribosome In
Pre-Accommodation State
pdb|3E1D|L Chain L, Structure Of The 50s Subunit Of E. Coli Ribosome In
Post-Accommodation State
pdb|3I1N|S Chain S, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I1P|S Chain S, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I1R|S Chain S, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I1T|S Chain S, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I20|S Chain S, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I22|S Chain S, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3KCR|S Chain S, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
Ribosomal Subnit. The 30s Ribosomal Subunit Can Be Found
In Pdb Entry 3kc4
pdb|2WWQ|S Chain S, E.Coli 70s Ribosome Stalled During Translation Of Tnac
Leader Peptide. This File Contains The 50s, The P-Site
Trna And The Tnac Leader Peptide (Part 2 Of 2).
pdb|1VT2|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
Cem-101. This File Contains The 50s Subunit Of The
Second 70s Ribosome.
pdb|3ORB|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
Cem-101. This File Contains The 50s Subunit Of The First
70s Ribosome Bound To Cem-101.
pdb|3OFQ|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
Erythromycin. This File Contains The 50s Subunit Of The
Second 70s Ribosome.
pdb|3OFR|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
Erythromycin. This File Contains The 50s Subunit Of The
First 70s Ribosome With Erthromycin Bound.
pdb|3OFC|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
Chloramphenicol. This File Contains The 50s Subunit Of
The First 70s Ribosome With Chloramphenicol Bound.
pdb|3OFD|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
Chloramphenicol. This File Contains The 50s Subunit Of
The Second 70s Ribosome.
pdb|3OFZ|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
Clindamycin. This File Contains The 50s Subunit Of The
First 70s Ribosome Bound To Clindamycin.
pdb|3OG0|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
Clindamycin. This File Contains The 50s Subunit Of The
Second 70s Ribosome.
pdb|3OAS|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
Telithromycin. This File Contains The 50s Subunit Of The
Second 70s Ribosome.
pdb|3OAT|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
Telithromycin. This File Contains The 50s Subunit Of The
First 70s Ribosome With Telithromycin Bound.
pdb|3IZT|T Chain T, Structural Insights Into Cognate Vs. Near-Cognate
Discrimination During Decoding. This Entry Contains The
Large Subunit Of A Ribosome Programmed With A
Near-Cognate Codon.
pdb|3IZU|T Chain T, Structural Insights Into Cognate Vs. Near-Cognate
Discrimination During Decoding. This Entry Contains The
Large Subunit Of A Ribosome Programmed With A Cognate
Codon
pdb|3J01|S Chain S, Structure Of The Ribosome-Secye Complex In The Membrane
Environment
pdb|3R8S|S Chain S, Structures Of The Bacterial Ribosome In Classical And
Hybrid States Of Trna Binding
pdb|3R8T|S Chain S, Structures Of The Bacterial Ribosome In Classical And
Hybrid States Of Trna Binding
pdb|3UOS|W Chain W, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
State On A Rotated Conformation Of The Ribosome (Without
Viomycin)
pdb|3J0T|U Chain U, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class2 Of The Six
Classes)
pdb|3J0W|U Chain U, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 4a Of The Six
Classes)
pdb|3J0Y|U Chain U, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 4b Of The Six
Classes)
pdb|3J11|U Chain U, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 3 Of The Six
Classes)
pdb|3J12|U Chain U, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 5 Of The Six
Classes)
pdb|3J14|U Chain U, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 6 Of The Six
Classes)
pdb|3J19|S Chain S, Structure Of The Bacterial Ribosome Complexed By
Tmrna-Smpb And Ef-G During Translocation And Mld-Loading
(50s Subunit)
pdb|4GAR|S Chain S, Allosteric Control Of The Ribosome By Small-Molecule
Antibiotics
pdb|4GAU|S Chain S, Allosteric Control Of The Ribosome By Small-Molecule
Antibiotics
Length = 110
Score = 67.0 bits (162), Expect = 9e-12, Method: Compositional matrix adjust.
Identities = 42/99 (42%), Positives = 59/99 (59%)
Query: 118 KQSPKKINLVAALVRGMRVEDALLQLQVTIKRAAKTVYQVIHSARANATHNHGLDPDRLL 177
+ S +K+ LVA L+RG +V AL L T K+AA V +V+ SA ANA HN G D D L
Sbjct: 11 RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70
Query: 178 VAEAFVGKGFFKKRVSYHSKGRSGIKVRPECRLTVVVRE 216
V + FV +G KR+ +KGR+ ++ +TVVV +
Sbjct: 71 VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109
>pdb|2GYA|Q Chain Q, Structure Of The 50s Subunit Of A Pre-Translocational E.
Coli Ribosome Obtained By Fitting Atomic Models For Rna
And Protein Components Into Cryo-Em Map Emd-1056
pdb|2GYC|Q Chain Q, Structure Of The 50s Subunit Of A Secm-Stalled E. Coli
Ribosome Complex Obtained By Fitting Atomic Models For
Rna And Protein Components Into Cryo-Em Map Emd-1143
Length = 106
Score = 67.0 bits (162), Expect = 1e-11, Method: Compositional matrix adjust.
Identities = 42/99 (42%), Positives = 59/99 (59%)
Query: 118 KQSPKKINLVAALVRGMRVEDALLQLQVTIKRAAKTVYQVIHSARANATHNHGLDPDRLL 177
+ S +K+ LVA L+RG +V AL L T K+AA V +V+ SA ANA HN G D D L
Sbjct: 7 RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 66
Query: 178 VAEAFVGKGFFKKRVSYHSKGRSGIKVRPECRLTVVVRE 216
V + FV +G KR+ +KGR+ ++ +TVVV +
Sbjct: 67 VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 105
>pdb|3BBO|U Chain U, Homology Model For The Spinach Chloroplast 50s Subunit
Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
Length = 199
Score = 66.6 bits (161), Expect = 1e-11, Method: Compositional matrix adjust.
Identities = 35/102 (34%), Positives = 61/102 (59%)
Query: 117 IKQSPKKINLVAALVRGMRVEDALLQLQVTIKRAAKTVYQVIHSARANATHNHGLDPDRL 176
I S K V +RG + L+ L++ RA ++++I+SA ANA+HN + L
Sbjct: 39 ISMSVDKARRVIDQIRGRSYAETLMILELMPYRACYPIFKLIYSAAANASHNKQFNKANL 98
Query: 177 LVAEAFVGKGFFKKRVSYHSKGRSGIKVRPECRLTVVVRELT 218
++++A V KG K+V ++GRS + +RP C +T+V+R++T
Sbjct: 99 IISKAEVNKGITLKKVKPRARGRSYMILRPTCHITIVLRDIT 140
>pdb|1BXE|A Chain A, Ribosomal Protein L22 From Thermus Thermophilus
Length = 113
Score = 66.2 bits (160), Expect = 2e-11, Method: Compositional matrix adjust.
Identities = 41/106 (38%), Positives = 64/106 (60%)
Query: 111 QAVLKGIKQSPKKINLVAALVRGMRVEDALLQLQVTIKRAAKTVYQVIHSARANATHNHG 170
+A+ + ++ SP+K+ LV L+RG +E+A L+ T KR A V +V+ SA ANA +NH
Sbjct: 4 KAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHD 63
Query: 171 LDPDRLLVAEAFVGKGFFKKRVSYHSKGRSGIKVRPECRLTVVVRE 216
DRL V A+V +G KRV ++GR+ I + +TV++ E
Sbjct: 64 XLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGE 109
>pdb|2FTC|M Chain M, Structural Model For The Large Subunit Of The Mammalian
Mitochondrial Ribosome
pdb|3IY9|M Chain M, Leishmania Tarentolae Mitochondrial Large Ribosomal
Subunit Model
Length = 110
Score = 62.8 bits (151), Expect = 2e-10, Method: Compositional matrix adjust.
Identities = 36/101 (35%), Positives = 57/101 (56%), Gaps = 1/101 (0%)
Query: 117 IKQSPKKINLVAALVRGMRVEDALLQLQVTIKRAAKTVYQVIHSARANATHNHGLD-PDR 175
IK S K+ +A L+RGM ++ AL QL+ K+ AK + +V+ A+ A +H ++
Sbjct: 6 IKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSN 65
Query: 176 LLVAEAFVGKGFFKKRVSYHSKGRSGIKVRPECRLTVVVRE 216
L +AE+ G+G KR+ YH +GR GI + C V + E
Sbjct: 66 LYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVE 106
>pdb|1I4J|A Chain A, Crystal Structure Of L22 Ribosomal Protein Mutant
pdb|1I4J|B Chain B, Crystal Structure Of L22 Ribosomal Protein Mutant
Length = 110
Score = 58.9 bits (141), Expect = 3e-09, Method: Compositional matrix adjust.
Identities = 39/106 (36%), Positives = 62/106 (58%), Gaps = 3/106 (2%)
Query: 111 QAVLKGIKQSPKKINLVAALVRGMRVEDALLQLQVTIKRAAKTVYQVIHSARANATHNHG 170
+A+ + ++ SP+K+ LV L+RG +E+A L+ T KR A V +V+ SA ANA +NH
Sbjct: 4 KAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHD 63
Query: 171 LDPDRLLVAEAFVGKGFFKKRVSYHSKGRSGIKVRPECRLTVVVRE 216
DRL V A+V +G V ++GR+ I + +TV++ E
Sbjct: 64 ALEDRLYVKAAYVDEG---PAVLPRARGRADIIKKRTSHITVILGE 106
>pdb|3IZR|V Chain V, Localization Of The Large Subunit Ribosomal Proteins Into
A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s
Ribosome
Length = 171
Score = 30.8 bits (68), Expect = 0.93, Method: Compositional matrix adjust.
Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 5/82 (6%)
Query: 149 RAAKTVYQVIHSARANATHNHGLDPDRLLVAEAFVGKGFFKKRVSYHSKGRSGIKVRPEC 208
++A+ + ++ +A +NA GLD D L V+ V + ++R +Y + GR + C
Sbjct: 87 KSARFILDLLKNAESNAEVK-GLDVDTLYVSHIQVNQAQKQRRRTYRAHGRINPYMSSPC 145
Query: 209 RLTVVVRE----LTAEEEAQIA 226
+ +++ E + E E+QIA
Sbjct: 146 HIELILSEKEEPVKKEPESQIA 167
>pdb|2ZKR|RR Chain r, Structure Of A Mammalian Ribosomal 60s Subunit Within An
80s Complex Obtained By Docking Homology Models Of The
Rna And Proteins Into An 8.7 A Cryo-Em Map
Length = 184
Score = 29.6 bits (65), Expect = 2.0, Method: Compositional matrix adjust.
Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
Query: 148 KRAAKTVYQVIHSARANATHNHGLDPDRLLVAEAFVGKGFFKKRVSYHSKGRSGIKVRPE 207
K++A+ + ++ +A +NA GLD D L++ V K +R +Y + GR +
Sbjct: 85 KKSAEFLLHMLKNAESNAELK-GLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSP 143
Query: 208 CRLTVVVRE 216
C + +++ E
Sbjct: 144 CHIEMILTE 152
>pdb|1RHI|2 Chain 2, Human Rhinovirus 3 Coat Protein
Length = 262
Score = 29.3 bits (64), Expect = 2.3, Method: Compositional matrix adjust.
Identities = 11/32 (34%), Positives = 17/32 (53%)
Query: 180 EAFVGKGFFKKRVSYHSKGRSGIKVRPECRLT 211
+A G F + + YHS GR+G + +C T
Sbjct: 84 DALKDMGVFGQNMFYHSLGRTGYTIHVQCNAT 115
>pdb|1R08|2 Chain 2, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|1R09|2 Chain 2, Human Rhinovirus 14 Complexed With Antiviral Compound R
61837
pdb|1RMU|2 Chain 2, Three-Dimensional Structures Of Drug-Resistant Mutants Of
Human Rhinovirus 14
pdb|2R04|2 Chain 2, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2R06|2 Chain 2, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2R07|2 Chain 2, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2RM2|2 Chain 2, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2RMU|2 Chain 2, Three-Dimensional Structures Of Drug-Resistant Mutants Of
Human Rhinovirus 14
pdb|2RR1|2 Chain 2, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2RS1|2 Chain 2, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2RS3|2 Chain 2, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|2RS5|2 Chain 2, Structural Analysis Of Antiviral Agents That Interact With
The Capsid Of Human Rhinoviruses
pdb|4RHV|2 Chain 2, The Use Of Molecular-Replacement Phases For The Refinement
Of The Human Rhinovirus 14 Structure
pdb|1HRI|2 Chain 2, Structure Determination Of Antiviral Compound Sch 38057
Complexed With Human Rhinovirus 14
pdb|1HRV|2 Chain 2, Hrv14SDZ 35-682 Complex
pdb|1RUJ|2 Chain 2, Rhinovirus 14 Mutant With Ser 1 223 Replaced By Gly
(S1223g)
pdb|1RUI|2 Chain 2, Rhinovirus 14 Mutant S1223g Complexed With Antiviral
Compound Win 52084
pdb|1RUH|2 Chain 2, Rhinovirus 14 Mutant N1219s Complexed With Antiviral
Compound Win 52084
pdb|1RUG|2 Chain 2, Rhinovirus 14 Mutant N1219s Complexed With Antiviral
Compound Win 52035
pdb|1RUF|2 Chain 2, Rhinovirus 14 (Hrv14) (Mutant With Asn 1 219 Replaced By
Ala (N219a In Chain 1)
pdb|1RUE|2 Chain 2, Rhinovirus 14 Site Directed Mutant N1219a Complexed With
Antiviral Compound Win 52035
pdb|1RUD|2 Chain 2, Rhinovirus 14 Mutant N1105s Complexed With Antiviral
Compound Win 52084
pdb|1RUC|2 Chain 2, Rhinovirus 14 Mutant N1105s Complexed With Antiviral
Compound Win 52035
pdb|1VRH|2 Chain 2, Hrv14/sdz 880-061 Complex
pdb|1RVF|2 Chain 2, Fab Complexed With Intact Human Rhinovirus
pdb|1D3I|2 Chain 2, Cryo-Em Structure Of Human Rhinovirus 14 (Hrv14) Complexed
With A Two-Domain Fragment Of Its Cellular Receptor,
Intercellular Adhesion Molecule-1 (D1d2-Icam-1).
Implications For Virus-Receptor Interactions. Alpha
Carbons Only
pdb|1NA1|B Chain B, The Structure Of Hrv14 When Complexed With Pleconaril
pdb|1NCQ|B Chain B, The Structure Of Hrv14 When Complexed With Pleconaril, An
Antiviral Compound
Length = 262
Score = 29.3 bits (64), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 12/32 (37%), Positives = 17/32 (53%)
Query: 180 EAFVGKGFFKKRVSYHSKGRSGIKVRPECRLT 211
+A G F + + +HS GRSG V +C T
Sbjct: 84 DALKDMGVFGQNMFFHSLGRSGYTVHVQCNAT 115
>pdb|2HWB|2 Chain 2, A Comparison Of The Anti-Rhinoviral Drug Binding Pocket In
Hrv14 And Hrv1a
pdb|2HWC|2 Chain 2, A Comparison Of The Anti-Rhinoviral Drug Binding Pocket In
Hrv14 And Hrv1a
Length = 262
Score = 29.3 bits (64), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 12/32 (37%), Positives = 17/32 (53%)
Query: 180 EAFVGKGFFKKRVSYHSKGRSGIKVRPECRLT 211
+A G F + + +HS GRSG V +C T
Sbjct: 84 DALKDMGVFGQNMFFHSLGRSGYTVHVQCNAT 115
>pdb|1K5M|B Chain B, Crystal Structure Of A Human Rhinovirus Type 14:human
Immunodeficiency Virus Type 1 V3 Loop Chimeric Virus Mn-
Iii-2
Length = 277
Score = 28.9 bits (63), Expect = 2.9, Method: Compositional matrix adjust.
Identities = 12/32 (37%), Positives = 17/32 (53%)
Query: 180 EAFVGKGFFKKRVSYHSKGRSGIKVRPECRLT 211
+A G F + + +HS GRSG V +C T
Sbjct: 84 DALKDMGVFGQNMFFHSLGRSGYTVHVQCNAT 115
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.131 0.373
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,906,570
Number of Sequences: 62578
Number of extensions: 231497
Number of successful extensions: 497
Number of sequences better than 100.0: 18
Number of HSP's better than 100.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 480
Number of HSP's gapped (non-prelim): 18
length of query: 270
length of database: 14,973,337
effective HSP length: 97
effective length of query: 173
effective length of database: 8,903,271
effective search space: 1540265883
effective search space used: 1540265883
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)