Citrus Sinensis ID: 040473

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
HDLACCCKAKLTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEEVASLVNSISQASSSASPADLSQKIFALSGSIQFRVAFGRRFQGVIFDNHKFHE
cccccccccccccccHHHcccccEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHHHHHHHHHHcccccccccccccccc
cccEEccccccHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHcHHHHHccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHcc
hdlaccckakltgvrkLSYNYLDvafepfgdhwRQMQKSCVIELFSMKRVQSFQFIREEEVASLVNSIsqasssaspadLSQKIFALSGSIQFRVAFGRRfqgvifdnhkfhe
hdlaccckakltgvrklsyNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEEVASLVNSISQASSSASPADLSQKIFALSGSIQFRVAFGRRFQGVIFDNHKFHE
HDLACCCKAKLTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEEVaslvnsisqasssaspadlsQKIFALSGSIQFRVAFGRRFQGVIFDNHKFHE
**LACCCKAKLTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEEVASL******************KIFALSGSIQFRVAFGRRFQGVIFDN*****
HDLACCCKAKLTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEEVASLVNSI*********ADLSQKIFALSGSIQFRVAFGRRFQG**********
HDLACCCKAKLTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEEVAS****************LSQKIFALSGSIQFRVAFGRRFQGVIFDNHKFHE
*DLACCCKAKLTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEEVASLVNSISQASSSASPADLSQKIFALSGSIQFRVAFGRRFQ***********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HDLACCCKAKLTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEEVASLVNSISQASSSASPADLSQKIFALSGSIQFRVAFGRRFQGVIFDNHKFHE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query113 2.2.26 [Sep-21-2011]
Q9LIP4 500 Cytochrome P450 71B36 OS= yes no 1.0 0.226 0.469 3e-30
Q9LIP5 500 Cytochrome P450 71B35 OS= no no 1.0 0.226 0.442 7e-28
Q9LIP3 500 Cytochrome P450 71B37 OS= no no 0.982 0.222 0.459 3e-27
Q9LIP6 500 Cytochrome P450 71B34 OS= no no 0.991 0.224 0.428 4e-26
O65788 502 Cytochrome P450 71B2 OS=A no no 1.0 0.225 0.460 9e-26
O64718 500 Cytochrome P450 71B9 OS=A no no 0.982 0.222 0.450 2e-25
Q9LVD2 502 Cytochrome P450 71B10 OS= no no 1.0 0.225 0.424 7e-25
Q9LTM3 502 Cytochrome P450 71B20 OS= no no 1.0 0.225 0.473 2e-24
Q9LTM4 502 Cytochrome P450 71B19 OS= no no 1.0 0.225 0.456 8e-24
Q9ZU07 496 Cytochrome P450 71B12 OS= no no 0.946 0.215 0.448 1e-23
>sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 Back     alignment and function desciption
 Score =  130 bits (327), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 53/113 (46%), Positives = 82/113 (72%)

Query: 1   HDLACCCKAKLTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEE 60
           HDL CC +  L G R LSYNYLD+AF PF D+W+++++ CV ELFS+KRVQSFQ I+E+E
Sbjct: 91  HDLHCCSRPSLAGPRALSYNYLDIAFSPFDDYWKELRRICVQELFSVKRVQSFQPIKEDE 150

Query: 61  VASLVNSISQASSSASPADLSQKIFALSGSIQFRVAFGRRFQGVIFDNHKFHE 113
           V  L++S+S+++S  +P +LS+K  +L+  +  +  FG  FQG + ++ +F +
Sbjct: 151 VKKLIDSVSESASQGTPVNLSEKFTSLTVRVTCKATFGVNFQGTVLNSDRFEK 203

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q9LIP5|C71BW_ARATH Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 Back     alignment and function description
>sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 Back     alignment and function description
>sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 Back     alignment and function description
>sp|O64718|C71B9_ARATH Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CYP71B9 PE=2 SV=3 Back     alignment and function description
>sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 Back     alignment and function description
>sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTM4|C71BJ_ARATH Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
255570189 362 cytochrome P450, putative [Ricinus commu 0.982 0.306 0.585 1e-35
224110848 427 cytochrome P450 [Populus trichocarpa] gi 1.0 0.264 0.575 8e-35
224102403 482 cytochrome P450 [Populus trichocarpa] gi 1.0 0.234 0.575 2e-34
224102385 482 cytochrome P450 [Populus trichocarpa] gi 1.0 0.234 0.575 2e-34
118485719 507 unknown [Populus trichocarpa] 1.0 0.222 0.575 2e-34
224102389 482 cytochrome P450 [Populus trichocarpa] gi 1.0 0.234 0.566 4e-34
16507125 500 cytochrome P450 [Citrus sinensis] 1.0 0.226 0.637 6e-34
255578379 507 cytochrome P450, putative [Ricinus commu 1.0 0.222 0.548 2e-32
255578383 504 cytochrome P450, putative [Ricinus commu 0.982 0.220 0.549 4e-32
255564492 499 cytochrome P450, putative [Ricinus commu 0.982 0.222 0.566 7e-31
>gi|255570189|ref|XP_002526055.1| cytochrome P450, putative [Ricinus communis] gi|223534636|gb|EEF36332.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 65/111 (58%), Positives = 91/111 (81%)

Query: 1   HDLACCCKAKLTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEE 60
           HDL+CC +  L G R+LSYNYLD+AF P+GD+WR+++K CV ELFS+KRVQSFQFIR+EE
Sbjct: 91  HDLSCCSRPSLVGARRLSYNYLDLAFSPYGDYWREIRKICVHELFSIKRVQSFQFIRDEE 150

Query: 61  VASLVNSISQASSSASPADLSQKIFALSGSIQFRVAFGRRFQGVIFDNHKF 111
           VA+L++SISQ+SS+A+P DL++K F+L+ +I FR+AFG  F+    +  +F
Sbjct: 151 VAALIDSISQSSSAATPVDLTEKFFSLTANITFRLAFGTSFEATDLEKDRF 201

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224110848|ref|XP_002315656.1| cytochrome P450 [Populus trichocarpa] gi|222864696|gb|EEF01827.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102403|ref|XP_002312665.1| cytochrome P450 [Populus trichocarpa] gi|222852485|gb|EEE90032.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102385|ref|XP_002312659.1| cytochrome P450 [Populus trichocarpa] gi|222852479|gb|EEE90026.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118485719|gb|ABK94709.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102389|ref|XP_002312660.1| cytochrome P450 [Populus trichocarpa] gi|222852480|gb|EEE90027.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|16507125|gb|AAL24049.1|AF426451_1 cytochrome P450 [Citrus sinensis] Back     alignment and taxonomy information
>gi|255578379|ref|XP_002530056.1| cytochrome P450, putative [Ricinus communis] gi|223530472|gb|EEF32356.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255578383|ref|XP_002530058.1| cytochrome P450, putative [Ricinus communis] gi|223530474|gb|EEF32358.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255564492|ref|XP_002523242.1| cytochrome P450, putative [Ricinus communis] gi|223537538|gb|EEF39163.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
TAIR|locus:2079311 500 CYP71B36 ""cytochrome P450, fa 1.0 0.226 0.407 8.9e-21
TAIR|locus:2079306 500 CYP71B35 ""cytochrome P450, fa 1.0 0.226 0.398 1.8e-19
TAIR|locus:2079316 500 CYP71B37 ""cytochrome P450, fa 0.982 0.222 0.396 1.1e-18
TAIR|locus:2031900 502 CYP71B2 ""cytochrome P450, fam 1.0 0.225 0.4 1.8e-18
TAIR|locus:2079251 500 CYP71B34 ""cytochrome P450, fa 0.991 0.224 0.375 7.9e-18
TAIR|locus:2165595 502 CYP71B10 ""cytochrome P450, fa 1.0 0.225 0.371 8e-18
TAIR|locus:2065254 500 CYP71B9 ""cytochrome P450, fam 0.982 0.222 0.387 2.2e-17
TAIR|locus:2031915 490 CYP71B28 ""cytochrome P450, fa 0.867 0.2 0.408 7.2e-17
TAIR|locus:2093516 502 CYP71B20 ""cytochrome P450, fa 1.0 0.225 0.403 1.3e-16
TAIR|locus:2093511 502 CYP71B19 ""cytochrome P450, fa 1.0 0.225 0.385 4.4e-16
TAIR|locus:2079311 CYP71B36 ""cytochrome P450, family 71, subfamily B, polypeptide 36"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 251 (93.4 bits), Expect = 8.9e-21, P = 8.9e-21
 Identities = 46/113 (40%), Positives = 67/113 (59%)

Query:     1 HDLACCCKAKLTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEE 60
             HDL CC +  L G R LSYNYLD+AF PF D+W+++++ CV ELFS+KRVQSFQ I+E+E
Sbjct:    91 HDLHCCSRPSLAGPRALSYNYLDIAFSPFDDYWKELRRICVQELFSVKRVQSFQPIKEDE 150

Query:    61 VXXXXXXXXXXXXXXXXXXXXQKIFALSGSIQFRVAFGRRFQGVIFDNHKFHE 113
             V                    +K  +L+  +  +  FG  FQG + ++ +F +
Sbjct:   151 VKKLIDSVSESASQGTPVNLSEKFTSLTVRVTCKATFGVNFQGTVLNSDRFEK 203
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2079306 CYP71B35 ""cytochrome P450, family 71, subfamily B, polypeptide 35"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079316 CYP71B37 ""cytochrome P450, family 71, subfamily B, polypeptide 37"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031900 CYP71B2 ""cytochrome P450, family 71, subfamily B, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079251 CYP71B34 ""cytochrome P450, family 71, subfamily B, polypeptide 34"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165595 CYP71B10 ""cytochrome P450, family 71, subfamily B, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065254 CYP71B9 ""cytochrome P450, family 71, subfamily B, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031915 CYP71B28 ""cytochrome P450, family 71, subfamily B, polypeptide 28"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093516 CYP71B20 ""cytochrome P450, family 71, subfamily B, polypeptide 20"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093511 CYP71B19 ""cytochrome P450, family 71, subfamily B, polypeptide 19"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.X.5125.1
annotation not avaliable (447 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-18
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 4e-18
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 1e-15
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 5e-14
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 6e-10
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 1e-08
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 5e-05
pfam00067 461 pfam00067, p450, Cytochrome P450 0.001
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information 
 Score = 78.7 bits (194), Expect = 2e-18
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 3/85 (3%)

Query: 14  VRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEEVASLVNSISQASS 73
           +  L+Y+  D+AF  +G  WRQM+K CV++LFS KR +S+  +R +EV S+V S+S  S+
Sbjct: 110 ISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWASVR-DEVDSMVRSVS--SN 166

Query: 74  SASPADLSQKIFALSGSIQFRVAFG 98
              P ++ + IF L+ +I +R AFG
Sbjct: 167 IGKPVNIGELIFTLTRNITYRAAFG 191

Length = 516
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 113
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.79
PLN02971 543 tryptophan N-hydroxylase 99.56
PLN03018 534 homomethionine N-hydroxylase 99.49
PLN02687 517 flavonoid 3'-monooxygenase 99.48
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.44
PLN03234 499 cytochrome P450 83B1; Provisional 99.44
PLN00168 519 Cytochrome P450; Provisional 99.44
PLN02655 466 ent-kaurene oxidase 99.43
PLN02394 503 trans-cinnamate 4-monooxygenase 99.39
PLN03112 514 cytochrome P450 family protein; Provisional 99.39
PLN02966 502 cytochrome P450 83A1 99.38
PLN02183 516 ferulate 5-hydroxylase 99.32
PTZ00404 482 cytochrome P450; Provisional 99.31
PLN02290 516 cytokinin trans-hydroxylase 99.26
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.26
PLN02738 633 carotene beta-ring hydroxylase 99.24
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.17
PLN02936 489 epsilon-ring hydroxylase 99.15
PLN03195 516 fatty acid omega-hydroxylase; Provisional 98.97
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 98.96
PLN02426 502 cytochrome P450, family 94, subfamily C protein 98.91
PLN02500 490 cytochrome P450 90B1 98.89
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 98.85
PLN02196 463 abscisic acid 8'-hydroxylase 98.84
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 98.69
PLN02302 490 ent-kaurenoic acid oxidase 98.67
PLN02648 480 allene oxide synthase 98.53
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 98.53
PLN02987 472 Cytochrome P450, family 90, subfamily A 98.28
PLN02774 463 brassinosteroid-6-oxidase 98.26
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.15
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.79  E-value=1.9e-18  Score=120.04  Aligned_cols=104  Identities=38%  Similarity=0.611  Sum_probs=92.6

Q ss_pred             CCccccCCCC-ccchhhhccCCcceeeccCchHHHHHHHHHHhhcCcHHHHhhHHHHHHHHHHHHHHHHHHhcCCCCcee
Q 040473            1 HDLACCCKAK-LTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEEVASLVNSISQASSSASPAD   79 (113)
Q Consensus         1 ~~~~fs~Rp~-~~~~~~~~~~~~~i~~~~~g~~w~~~Rr~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~   79 (113)
                      ||..|++||. ..+.+.+..++.++++++||+.|+.+||++...+++....+.......+|++.+++.+.+ ..+++++|
T Consensus        88 ~d~~fa~Rp~~~~~~~~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~-~~~~~~vd  166 (489)
T KOG0156|consen   88 QDLEFADRPDPTATLKYLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSK-SKKGEPVD  166 (489)
T ss_pred             CCccccCCCCchhhHHHhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHh-cCCCceee
Confidence            6889999998 335577776779999999999999999999999999999999988889999999999987 33338999


Q ss_pred             hHHHHHHHHHHHHHHHHHhccccCcc
Q 040473           80 LSQKIFALSGSIQFRVAFGRRFQGVI  105 (113)
Q Consensus        80 ~~~~~~~~~~~vi~~~~fg~~~~~~~  105 (113)
                      +...+..++.|||++++||+++.+++
T Consensus       167 l~~~l~~~~~nvI~~~~fG~rf~~~~  192 (489)
T KOG0156|consen  167 LSELLDLLVGNVICRMLFGRRFEEED  192 (489)
T ss_pred             HHHHHHHHHHHHHHHHHhCCccccCC
Confidence            99999999999999999999998854

>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 3e-20
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-13
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-12
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 4e-10
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 3e-07
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 5e-06
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 8e-06
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 9e-05
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score = 83.1 bits (206), Expect = 3e-20
 Identities = 14/90 (15%), Positives = 31/90 (34%), Gaps = 4/90 (4%)

Query: 16  KLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEEVASLVNSI----SQA 71
              Y             W++ + +   E+ + +  ++F  + +      V+ +     +A
Sbjct: 90  HQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKA 149

Query: 72  SSSASPADLSQKIFALSGSIQFRVAFGRRF 101
            S     D+S  +F  +      V FG R 
Sbjct: 150 GSGNYSGDISDDLFRFAFESITNVIFGERQ 179
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.51
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.43
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.41
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.39
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.37
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.32
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.32
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.31
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.31
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.3
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.26
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.25
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.18
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.14
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.11
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.08
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.05
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.04
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.04
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.01
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.01
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.0
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 98.98
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 98.94
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 98.92
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 98.91
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 98.9
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 98.89
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 98.89
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 98.88
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 98.87
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 98.86
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 98.85
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 98.84
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 98.84
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 98.84
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 98.82
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 98.82
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 98.79
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 98.78
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 98.78
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 98.78
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 98.78
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 98.77
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 98.76
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 98.76
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 98.75
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 98.69
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 98.69
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 98.68
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 98.68
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 98.67
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 98.67
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 98.65
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 98.65
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 98.65
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 98.64
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 98.6
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 98.59
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 98.59
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 98.58
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 98.53
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 98.51
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 98.5
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 98.5
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 98.5
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 98.5
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 98.38
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 98.35
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 98.18
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 98.16
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.13
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 98.0
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 97.49
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 96.31
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 95.39
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
Probab=99.51  E-value=4.1e-14  Score=97.13  Aligned_cols=102  Identities=16%  Similarity=0.294  Sum_probs=84.1

Q ss_pred             CCccccCCCCccchhhhccCCcceeeccCchHHHHHHHHHHhhcCcH--HHHhhHHHHHHHHHHHHHHHHHHhcCCCCce
Q 040473            1 HDLACCCKAKLTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSM--KRVQSFQFIREEEVASLVNSISQASSSASPA   78 (113)
Q Consensus         1 ~~~~fs~Rp~~~~~~~~~~~~~~i~~~~~g~~w~~~Rr~~~~~~~~~--~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~   78 (113)
                      ++..|++||.......+..++.+++++++|+.|+.+||++. +.|+.  ..+..+.+.+.+++..+++.+.+  ..+.++
T Consensus        71 ~~~~f~~rp~~~~~~~~~~~~~gl~~~~~g~~wr~~Rr~~~-~~f~~~~~~~~~~~~~i~~~~~~l~~~l~~--~~~~~v  147 (494)
T 3swz_A           71 KGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAM-ATFALFKDGDQKLEKIICQEISTLCDMLAT--HNGQSI  147 (494)
T ss_dssp             TTTTTBBCCCCHHHHHHTTTTCSSSSSCSSHHHHHHHHHHH-HHTTTTSSSTTCHHHHHHHHHHHHHHHHHH--TTTEEE
T ss_pred             CcHhhCCCCCcHHHHHhccCCCCeEeCCCCHHHHHHHHHHH-HHHHHhcchHHHHHHHHHHHHHHHHHHHHH--cCCCcc
Confidence            35689999987766656555567888888999999999998 56653  34677899999999999999876  345789


Q ss_pred             ehHHHHHHHHHHHHHHHHHhccccCcc
Q 040473           79 DLSQKIFALSGSIQFRVAFGRRFQGVI  105 (113)
Q Consensus        79 ~~~~~~~~~~~~vi~~~~fg~~~~~~~  105 (113)
                      |+...+..+++++|+.++||.++..++
T Consensus       148 d~~~~~~~~t~dvi~~~~fG~~~~~~~  174 (494)
T 3swz_A          148 DISFPVFVAVTNVISLICFNTSYKNGD  174 (494)
T ss_dssp             CCHHHHHHHHHHHHHHHHHSCCCCTTC
T ss_pred             cHHHHHHHHHHHHHHHHHcCCcCCCCC
Confidence            999999999999999999999986554
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 113
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 8e-04
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 0.003
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 35.1 bits (79), Expect = 8e-04
 Identities = 21/114 (18%), Positives = 34/114 (29%), Gaps = 4/114 (3%)

Query: 1   HDLACCCKAKLTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKR-VQSFQFIREE 59
                  +  L    K++     +    +G  W   ++  V          +SF+    E
Sbjct: 63  QSEIFADRPCLPLFMKMTKMG-GLLNSRYGRGWVDHRRLAVNSFRYFGYGQKSFESKILE 121

Query: 60  EVASLVNSISQASSSASPADLSQKIFALSGSIQFRVAFGRRFQGVIFDNHKFHE 113
           E     ++I        P D  Q I     +I   + FG RF     D     E
Sbjct: 122 ETKFFNDAIETYKG--RPFDFKQLITNAVSNITNLIIFGERFTYEDTDFQHMIE 173
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.13
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.04
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.02
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 98.71
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 98.7
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 98.69
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 98.57
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 98.56
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 98.52
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 98.37
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 98.35
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 98.34
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 98.28
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 98.17
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 98.14
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 98.1
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 97.85
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 97.8
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 97.65
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 96.9
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 96.49
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.13  E-value=7e-11  Score=78.52  Aligned_cols=97  Identities=12%  Similarity=0.202  Sum_probs=79.6

Q ss_pred             cccCCCCccchhhhccCCcceeeccCchHHHHHHHHHHhhcCcHHHHhhHHHHHHHHHHHHHHHHHHhcCCCCceehHHH
Q 040473            4 ACCCKAKLTGVRKLSYNYLDVAFEPFGDHWRQMQKSCVIELFSMKRVQSFQFIREEEVASLVNSISQASSSASPADLSQK   83 (113)
Q Consensus         4 ~fs~Rp~~~~~~~~~~~~~~i~~~~~g~~w~~~Rr~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~   83 (113)
                      .|++|+........   ..++.++ +|+.|+.+|+++. +.|+++.++.+.+.++++++.++..+.+....+.++++.+.
T Consensus        74 ~~~~~~~~~~~~~~---~~~i~~~-~g~~~~~~R~~~~-~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~dl~~~  148 (472)
T d1tqna_          74 VFTNRRPFGPVGFM---KSAISIA-EDEEWKRLRSLLS-PTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDV  148 (472)
T ss_dssp             TCCBCCCCSCCGGG---GGSTTTC-CHHHHHHHHHHTT-GGGSHHHHHTTHHHHHHHHHHHHHHHHHHHHHSSCEEHHHH
T ss_pred             cccCCccccccccc---CCceecc-CcHHHHHhhhhcC-ccccchhhhcccchhhhhhhcccccccccccccccchhhhh
Confidence            46666654433322   2455554 6999999999998 68899999999999999999999999887667789999999


Q ss_pred             HHHHHHHHHHHHHHhccccCcc
Q 040473           84 IFALSGSIQFRVAFGRRFQGVI  105 (113)
Q Consensus        84 ~~~~~~~vi~~~~fg~~~~~~~  105 (113)
                      +.++++++++.++||.+++..+
T Consensus       149 ~~~~~~~v~~~~~~G~~~~~~~  170 (472)
T d1tqna_         149 FGAYSMDVITSTSFGVNIDSLN  170 (472)
T ss_dssp             HHHHHHHHHHHTSSCCCCCGGG
T ss_pred             hhccchhhhhheeccccccccc
Confidence            9999999999999999986543
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure