Citrus Sinensis ID: 040484

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----

MEEQAEVKLLGRWFSVFSVRVEWALKLKGIKYVKIEEDTTNKSSLLLNSNPIYKRIPVLFHNEKCFSESLVIIEYIDDTWKHNPSILPQDPAERAMAQVLRNVIFSRGERQERQVKQIKDAMEVIEKVLMLELKGKKFFGGDADVGLIDIVLGWLPIWLDAIGEAAARTQIIFDSQKYTCWDKWTKNFSELPFV

ccccccEEEEcccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHccccccccEEEEccEEEccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccc

***QAEVKLLGRWFSVFSVRVEWALKLKGIKYVKIEEDTTNKSSLLLNSNPIYKRIPVLFHNEKCFSESLVIIEYIDDTWKHNPSILPQDPAERAMAQVLRNVIFSRGERQERQVKQIKDAMEVIEKVLMLELKGKKFFGGDADVGLIDIVLGWLPIWLDAIGEAAARTQIIFDSQKYTCWDKWTKNFSELPFV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEEQAEVKLLGRWFSVFSVRVEWALKLKGIKYVKIEEDTTNKSSLLLNSNPIYKRIPVLFHNEKCFSESLVIIEYIDDTWKHNPSILPQDPAERAMAQVLRNVIFSRGERQERQVKQIKDAMEVIEKVLMLELKGKKFFGGDADVGLIDIVLGWLPIWLDAIGEAAARTQIIFDSQKYTCWDKWTKNFSELPFV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Glutathione S-transferase U6	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	probable	Q9ZW26

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GWC, chain A
Confidence level:very confident
Coverage over the Query: 4-194
View the alignment between query and template
View the model in PyMOL