BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 040493
         (69 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3TVE|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The Cognate
          Trna-Leu Complex
          Length = 66

 Score = 30.4 bits (67), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 1  MKKGLHPQMQWISYVTQSGRLMHVMMTK----IHNVGKVYHFRARRQ-MAQSIGQVAKFR 55
          MK+G+HP++     +   G ++    TK    +    K + F   +Q    + G+V +F+
Sbjct: 1  MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQ 60

Query: 56 RRY 58
          RRY
Sbjct: 61 RRY 63


>pdb|3TVH|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The Second
          70s Molecule In The Asymmetric Unit For The Cognate
          Trna-Leu Complex
          Length = 63

 Score = 30.0 bits (66), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 1  MKKGLHPQMQWISYVTQSGRLMHVMMTK----IHNVGKVYHFRARRQ-MAQSIGQVAKFR 55
          MK+G+HP++     +   G ++    TK    +    K + F   +Q    + G+V +F+
Sbjct: 1  MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQ 60

Query: 56 RRY 58
          RRY
Sbjct: 61 RRY 63


>pdb|2J01|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Mrna, Trna And Paromomycin (Part 2 Of
          4). This File Contains The 50s Subunit From Molecule I.
 pdb|2J03|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Mrna, Trna And Paromomycin (Part 4 Of
          4). This File Contains The 50s Subunit From Molecule
          Ii.
 pdb|2HGJ|3 Chain 3, Crystal Structure Of The 70s Thermus Thermophilus
          Ribosome Showing How The 16s 3'-End Mimicks Mrna E And
          P Codons. This Entry 2hgj Contains 50s Ribosomal
          Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb
          Entry 2hgi.
 pdb|2HGQ|3 Chain 3, Crystal Structure Of The 70s Thermus Thermophilus
          Ribosome With Translocated And Rotated Shine-Dalgarno
          Duplex. This Entry 2hgq Contains 50s Ribosomal Subunit.
          The 30s Ribosomal Subunit Can Be Found In Pdb Entry
          2hgp.
 pdb|2HGU|3 Chain 3, 70s T.Th. Ribosome Functional Complex With Mrna And E-
          And P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s
          Ribosomal Subunit. The 30s Ribosomal Subunit Can Be
          Found In Pdb Entry 2hgr.
 pdb|2V47|4 Chain 4, Structure Of The Ribosome Recycling Factor Bound To The
          Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe
          And Trna-Fmet (Part 2 Of 4). This File Contains The 50s
          Subunit For Molecule 1.
 pdb|2V49|4 Chain 4, Structure Of The Ribosome Recycling Factor Bound To The
          Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe
          And Trna-Fmet (Part 4 Of 4). This File Contains The 50s
          Subunit Of Molecule 2.
 pdb|2WDI|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A-Site Trna,
          Deacylated P-Site Trna, And E-Site Trna. This File
          Contains The 50s Subunit For Molecule I.
 pdb|2WDJ|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A-Site Trna,
          Deacylated P-Site Trna, And E-Site Trna. This File
          Contains The 50s Subunit For Molecule Ii.
 pdb|2WDL|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A- And P-Site
          Trnas, And E-Site Trna.  This File Contains The 50s
          Subunit For Molecule I.
 pdb|2WDN|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A- And P-Site
          Trnas, And E-Site Trna.  This File Contains The 50s
          Subunit For Molecule Ii.
 pdb|2WH2|4 Chain 4, Insights Into Translational Termination From The
          Structure Of Rf2 Bound To The Ribosome
 pdb|3HUX|4 Chain 4, Structure Of Ef-P Bound To The 70s Ribosome; This File
          Contains The 50s Subunit For Molecule I.
 pdb|3HUZ|4 Chain 4, Structure Of Ef-P Bound To The 70s Ribosome; This File
          Contains The 50s Subunit For Molecule Ii.
 pdb|2WRJ|4 Chain 4, The Structure Of The Ribosome With Elongation Factor G
          Trapped In The Post-Translocational State (Part 2 Of
          4).
 pdb|2WRL|4 Chain 4, The Structure Of The Ribosome With Elongation Factor G
          Trapped In The Post-Translocational State. (Part 4 Of
          4).
 pdb|2WRO|4 Chain 4, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
          And Trna (Part 2 Of 4).
 pdb|2WRR|4 Chain 4, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
          And Trna (Part 4 Of 4).
 pdb|3KIR|4 Chain 4, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Precleavage State; Part 2 Of 4)
 pdb|3KIT|4 Chain 4, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Precleavage State; Part 4 Of 4)
 pdb|3KIW|4 Chain 4, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Postcleavage State; Part 2 Of 4)
 pdb|3KIY|4 Chain 4, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Postcleavage State; Part 4 Of 4)
 pdb|3KNI|4 Chain 4, The Structures Of Viomycin Bound To The 70s Ribosome.
          This File Contains The 50s Subunit For Molecule I
 pdb|3KNK|4 Chain 4, The Structures Of Viomycin Bound To The 70s Ribosome.
          This File Contains The 50s Subunit For Molecule Ii.
 pdb|3KNM|4 Chain 4, The Structures Of Capreomycin Bound To The 70s Ribosome.
          Thi Contains The 50s Subunit For Molecule I.
 pdb|3KNO|4 Chain 4, The Structures Of Capreomycin Bound To The 70s Ribosome.
          Thi Contains The 50s Subunit For Molecule Ii
 pdb|3I8F|4 Chain 4, Elongation Complex Of The 70s Ribosome With Three Trnas
          And Entry 3i8f Contains 50s Ribosomal Subunit. The 30s
          Ribosoma Can Be Found In Pdb Entry 3i8g. Molecule B In
          The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
          (50s).
 pdb|3I8I|4 Chain 4, Elongation Complex Of The 70s Ribosome With Three Trnas
          And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s
          Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In
          The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
          (30s).
 pdb|3I9C|4 Chain 4, Initiation Complex Of 70s Ribosome With Two Trnas And
          Mrna. 3i9c Contains 50s Ribosomal Subunit Of Molecule
          B. The 30s Subunit Can Be Found In Pdb Entry 3i9b.
          Molecule A In The S Asymmetric Unit Is Deposited As
          3i9d (30s) And 3i9e (50s)
 pdb|3I9E|4 Chain 4, Initiation Complex Of 70s Ribosome With Two Trnas And
          Mrna. 3i9e Contains 50s Ribosomal Subunit Of Molecule
          A. The 30s Subunit Can Be Found In Pdb Entry 3i9d.
          Molecule B In The S Asymmetric Unit Is Deposited As
          3i9b (30s) And 3i9c (50s)
 pdb|2X9S|4 Chain 4, Structure Of The 70s Ribosome Bound To Release Factor 2
          And A Substrate Analog Provides Insights Into Catalysis
          Of Peptide Release
 pdb|2X9U|4 Chain 4, Structure Of The 70s Ribosome Bound To Release Factor 2
          And A Substrate Analog Provides Insights Into Catalysis
          Of Peptide Release
 pdb|3MRZ|1 Chain 1, Recognition Of The Amber Stop Codon By Release Factor
          Rf1. This Entry 3mrz Contains 50s Ribosomal Subunit.
          The 30s Ribosomal Subunit Can Be Found In Pdb Entry
          3ms0. Molecule A In The Same Asymmetric Unit Is
          Deposited As 3mr8 (50s) And 3ms1 (30s).
 pdb|3MS1|1 Chain 1, Recognition Of The Amber Stop Codon By Release Factor
          Rf1. This Entry 3ms1 Contains 50s Ribosomal Subunit.
          The 30s Ribosomal Subunit Can Be Found In Pdb Entry
          3mr8. Molecule B In The Same Asymmetric Unit Is
          Deposited As 3mrz (50s) And 3ms0 (30s).
 pdb|2XG0|4 Chain 4, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
          70s Ribosome (Part 2 Of 4)
 pdb|2XG2|4 Chain 4, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
          70s Ribosome (Part 4 Of 4)
 pdb|3OH5|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Chloramphenicol. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3OH7|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Chloramphenicol. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3OHJ|4 Chain 4, Structure Of The Thermus Thermophilus Ribosome Complexed
          With Erythromycin. This File Contains The 50s Subunit
          Of One 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes.
 pdb|3OHK|4 Chain 4, Structure Of The Thermus Thermophilus Ribosome Complexed
          With Erythromycin. This File Contains The 50s Subunit
          Of One 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes.
 pdb|3OHZ|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Azithromycin. This File Contains The 50s
          Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3OI1|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Azithromycin. This File Contains The 50s
          Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3OI3|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Telithromycin. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3OI5|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Telithromycin. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|2XQE|4 Chain 4, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The
          70s Ribosome With A Gtp Analog
 pdb|2XTG|4 Chain 4, Trna Tranlocation On The 70s Ribosome: The        Pre-
          Translocational Translocation Intermediate Ti(Pre)
 pdb|2XUX|4 Chain 4, Trna Translocation On The 70s Ribosome: The Post-
          Translocational Translocation Intermediate Ti(Post)
 pdb|2Y0V|4 Chain 4, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To
          A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y0X|4 Chain 4, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To
          A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y0Z|4 Chain 4, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y11|4 Chain 4, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To
          A Cognate Codon On The 70s Ribosome.
 pdb|2Y13|4 Chain 4, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y15|4 Chain 4, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Cognate Codon On The 70s Ribosome.
 pdb|2Y17|4 Chain 4, Ef-Tu Complex 3
 pdb|2Y19|4 Chain 4, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To
          A Cognate Codon On The 70s Ribosome.
 pdb|3ZVP|4 Chain 4, Crystal Structure Of The Hybrid State Of Ribosome In
          Complex With The Guanosine Triphosphatase Release
          Factor 3
 pdb|3UXQ|4 Chain 4, The Structure Of Thermorubin In Complex With The 70s
          Ribosome From Thermus Thermophilus. This File Contains
          The 50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3UXR|4 Chain 4, The Structure Of Thermorubin In Complex With The 70s
          Ribosome From Thermus Thermophilus. This File Contains
          The 50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3UYE|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Leu Complex
 pdb|3UYG|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Leu Complex
 pdb|3UZ1|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Leu Complex With Paromomycin
 pdb|3UZ2|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The Second
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Leu Complex With Paromomycin.
 pdb|3UZ8|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The Second
          70s Molecule In The Asymmetric Unit For The Cognate
          Trna-Tyr Complex.
 pdb|3UZ9|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The Cognate
          Trna-Tyr Complex.
 pdb|3UZF|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Tyr Complex
 pdb|3UZH|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The Second
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Tyr Complex.
 pdb|3UZK|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Tyr Complex With Paromomycin
 pdb|3UZN|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The Second
          70s Molecule In The Asymmetric Unit For The
          Near-cognate Trna-tyr Complex With Paromomycin
 pdb|4ABS|4 Chain 4, Complex Of Smpb, A Tmrna Fragment And
          Ef-Tu-Gdp-Kirromycin With The 70s Ribosome
 pdb|4DHA|4 Chain 4, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|4DHC|4 Chain 4, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|3V23|4 Chain 4, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
          Pdb Entry Contains Coordinates For The 50s Subunit Of
          The 1st Ribosome In The Asu
 pdb|3V25|4 Chain 4, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
          Pdb Entry Contains Coordinates For The 50s Subunit Of
          The 2nd Ribosome In The Asu
 pdb|3V27|4 Chain 4, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
          Pdb Entry Contains Coordinates For The 50s Subunit Of
          The 1st Ribosome In The Asu
 pdb|3V29|4 Chain 4, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
          Entry Contains The 50s Subunit Of The 2nd Molecule In
          The Asu.
 pdb|3V2D|4 Chain 4, Crystal Structure Of Yfia Bound To The 70s Ribosome.
          This Pdb Entry Contains Coordinates For The 50s Subunit
          Of The 1st Ribosome In The Asu
 pdb|3V2F|4 Chain 4, Crystal Structure Of Yfia Bound To The 70s Ribosome.
          This Pdb Entry Contains Coordinates For The 50s Subunit
          Of The 2nd Ribosome In The Asu
 pdb|4G5L|4 Chain 4, Crystal Structure Of The 70s Ribosome With Tetracycline.
          This Entry Contains The 50s Subunit Of Molecule A.
 pdb|4G5N|4 Chain 4, Crystal Structure Of The 70s Ribosome With Tetracycline.
          This Entry Contains The 50s Subunit Of Molecule B.
 pdb|4G5U|4 Chain 4, Crystal Structure Of The 70s Ribosome With Tigecycline.
          This Entry Contains The 50s Subunit Of Molecule A.
 pdb|4G5W|4 Chain 4, Crystal Structure Of The 70s Ribosome With Tigecycline.
          This Entry Contains The 50s Subunit Of Molecule B
          Length = 71

 Score = 30.0 bits (66), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 1  MKKGLHPQMQWISYVTQSGRLMHVMMTK----IHNVGKVYHFRARRQ-MAQSIGQVAKFR 55
          MK+G+HP++     +   G ++    TK    +    K + F   +Q    + G+V +F+
Sbjct: 1  MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQ 60

Query: 56 RRY 58
          RRY
Sbjct: 61 RRY 63


>pdb|2AW4|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 50s Subunit Of One 70s Ribosome. The
          Entire Crystal Structure Contains Two 70s Ribosomes And
          Is Described In Remark 400.
 pdb|2AWB|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 50s Subunit Of The Second 70s Ribosome.
          The Entire Crystal Structure Contains Two 70s Ribosomes
          And Is Described In Remark 400.
 pdb|1VS6|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|1VS8|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|2J28|Z Chain Z, Model Of E. Coli Srp Bound To 70s Rncs
 pdb|2VHM|Z Chain Z, Structure Of Pdf Binding Helix In Complex With The
          Ribosome (Part 1 Of 4)
 pdb|2VHN|Z Chain Z, Structure Of Pdf Binding Helix In Complex With The
          Ribosome. (Part 2 Of 4)
 pdb|2RDO|Z Chain Z, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound
 pdb|3BBX|Z Chain Z, The Hsp15 Protein Fitted Into The Low Resolution Cryo-Em
          Map 50s.Nc-Trna.Hsp15 Complex
 pdb|3E1B|S Chain S, Structure Of The 50s Subunit Of E. Coli Ribosome In
          Pre-Accommodation State
 pdb|3E1D|S Chain S, Structure Of The 50s Subunit Of E. Coli Ribosome In
          Post-Accommodation State
 pdb|3IYX|A Chain A, Coordinates Of The B1b Bridge-Forming Protein Structures
          Fitted Into The Cryo-Em Map Of E.Coli 70s Ribosome
          (Emd-1056)
 pdb|3IYY|A Chain A, Coordinates Of The B1b Bridge-Forming Protein Structures
          Fitted Into The Cryo-Em Map Of Efg.Gdpnp-Bound E.Coli
          70s Ribosome(Emd-1363)
 pdb|3IZT|BB Chain b, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Large Subunit Of A Ribosome Programmed With A
          Near-Cognate Codon.
 pdb|3IZU|BB Chain b, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Large Subunit Of A Ribosome Programmed With A Cognate
          Codon
 pdb|3J0T|2 Chain 2, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class2 Of The Six
          Classes)
 pdb|3J0W|2 Chain 2, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 4a Of The Six
          Classes)
 pdb|3J0Y|2 Chain 2, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 4b Of The Six
          Classes)
 pdb|3J11|2 Chain 2, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 3 Of The Six
          Classes)
 pdb|3J12|2 Chain 2, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 5 Of The Six
          Classes)
 pdb|3J14|2 Chain 2, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 6 Of The Six
          Classes)
          Length = 70

 Score = 29.3 bits (64), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 1  MKKGLHPQMQWISYVTQSGRLMHVMMTKIH----NVGKVYH--FRARRQMAQSIGQVAKF 54
          MKK +HP+ + I+     G +M +  T  H    +V    H  F  +++   + G+V +F
Sbjct: 1  MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRF 60

Query: 55 RRRY 58
           +R+
Sbjct: 61 NKRF 64


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.130    0.383 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,834,360
Number of Sequences: 62578
Number of extensions: 49230
Number of successful extensions: 120
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 120
Number of HSP's gapped (non-prelim): 4
length of query: 69
length of database: 14,973,337
effective HSP length: 39
effective length of query: 30
effective length of database: 12,532,795
effective search space: 375983850
effective search space used: 375983850
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)