BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 040514
         (51 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q0C7C4|U483_AEDAE UPF0483 protein AAEL000016 OS=Aedes aegypti GN=AAEL000016 PE=3 SV=1
          Length = 275

 Score = 32.7 bits (73), Expect = 0.61,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 23/44 (52%)

Query: 6   KEQGMVLLESFVDPVVIYHSKGHTIPRIDERGQETMLSFIQKFQ 49
           KE  M L ++F DP ++ H  GH +P    + Q  +  F ++ Q
Sbjct: 192 KEMSMALADTFTDPQILTHPGGHFLPAQASQKQTYVEFFRERLQ 235


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.324    0.141    0.400 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,625,751
Number of Sequences: 539616
Number of extensions: 472457
Number of successful extensions: 827
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 826
Number of HSP's gapped (non-prelim): 1
length of query: 51
length of database: 191,569,459
effective HSP length: 24
effective length of query: 27
effective length of database: 178,618,675
effective search space: 4822704225
effective search space used: 4822704225
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 55 (25.8 bits)