BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 040528
         (86 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1YY4|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With
           1-Chloro-6-(4-Hydroxy-Phenyl)-Naphthalen-2-Ol
 pdb|1YY4|B Chain B, Crystal Structure Of Estrogen Receptor Beta Complexed With
           1-Chloro-6-(4-Hydroxy-Phenyl)-Naphthalen-2-Ol
 pdb|1YYE|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With
           Way-202196
 pdb|1YYE|B Chain B, Crystal Structure Of Estrogen Receptor Beta Complexed With
           Way-202196
          Length = 268

 Score = 26.2 bits (56), Expect = 4.8,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query: 41  LMELKSCSNEIVIF-----FINSQADIGPDCCRTGLQCSPLSDSRLKKGT 85
           L+ +K C N + ++      +N+    G     TG +CSP  DS+ K+G+
Sbjct: 214 LLNMK-CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGS 262


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.132    0.412 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,340,943
Number of Sequences: 62578
Number of extensions: 70815
Number of successful extensions: 108
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 107
Number of HSP's gapped (non-prelim): 1
length of query: 86
length of database: 14,973,337
effective HSP length: 54
effective length of query: 32
effective length of database: 11,594,125
effective search space: 371012000
effective search space used: 371012000
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)