BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 040541
         (69 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q7VAP7|SYY_PROMA Tyrosine--tRNA ligase OS=Prochlorococcus marinus (strain SARG /
           CCMP1375 / SS120) GN=tyrS PE=3 SV=1
          Length = 416

 Score = 29.3 bits (64), Expect = 8.4,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 2   SDWGPVFVAVILFVLLSPGLLFQVPGRHRCVEFGNFQTSGAAIMVHSLLYFALVCVFFLA 61
           S+W   F  V +  LLS   + Q+  +    EF N  TSG +I +H  LY        +A
Sbjct: 146 SEWLEGFDMVQIIDLLSKSTVGQMLAKE---EFANRYTSGTSIALHEFLYPLFQGYDSVA 202

Query: 62  VKVHLYLG 69
           V+  + LG
Sbjct: 203 VQADVELG 210


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.337    0.150    0.490 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 23,758,450
Number of Sequences: 539616
Number of extensions: 710183
Number of successful extensions: 2423
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2423
Number of HSP's gapped (non-prelim): 1
length of query: 69
length of database: 191,569,459
effective HSP length: 41
effective length of query: 28
effective length of database: 169,445,203
effective search space: 4744465684
effective search space used: 4744465684
T: 11
A: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 55 (25.8 bits)