Query         040603
Match_columns 172
No_of_seqs    178 out of 376
Neff          6.2 
Searched_HMMs 46136
Date          Fri Mar 29 09:59:26 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/040603.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/040603hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14009 DUF4228:  Domain of un 100.0 9.7E-41 2.1E-45  261.1   9.1  105    1-107     1-105 (181)
  2 PF02824 TGS:  TGS domain;  Int  78.0     3.7   8E-05   26.9   3.5   25   20-44      1-25  (60)
  3 TIGR03793 TOMM_pelo TOMM prope  77.3     3.2 6.9E-05   29.1   3.2   25   73-98     51-75  (77)
  4 PF15386 Tantalus:  Drosophila   60.2     5.4 0.00012   26.9   1.3   19  153-171    29-48  (61)
  5 TIGR01323 nitrile_alph nitrile  50.2      19 0.00042   29.3   3.2   29   73-101   145-174 (185)
  6 PRK08053 sulfur carrier protei  49.5      63  0.0014   21.2   5.2   22   23-44      3-24  (66)
  7 PRK00994 F420-dependent methyl  49.4      58  0.0013   27.9   6.0   78   17-106    61-145 (277)
  8 cd00178 STI Soybean trypsin in  48.6      14 0.00031   29.3   2.3   19   67-85      6-24  (172)
  9 cd01668 TGS_RelA_SpoT TGS_RelA  48.6      25 0.00053   21.8   3.0   23   22-44      3-25  (60)
 10 PF00197 Kunitz_legume:  Trypsi  45.5      19  0.0004   28.7   2.5   20   67-86      6-25  (176)
 11 PRK05659 sulfur carrier protei  45.4      21 0.00046   23.2   2.4   22   23-44      3-24  (66)
 12 PRK06944 sulfur carrier protei  44.8      82  0.0018   20.2   5.5   54   23-81      3-60  (65)
 13 TIGR01683 thiS thiamine biosyn  44.0      69  0.0015   20.8   4.7   55   23-81      1-59  (64)
 14 cd00565 ThiS ThiaminS ubiquiti  38.8      56  0.0012   21.2   3.7   23   23-45      2-24  (65)
 15 smart00452 STI Soybean trypsin  37.3      27 0.00058   27.8   2.2   19   67-85      5-23  (172)
 16 PF08140 Cuticle_1:  Crustacean  36.8      20 0.00042   22.2   1.0   27   22-50      5-31  (40)
 17 COG1927 Mtd Coenzyme F420-depe  35.8      53  0.0011   27.8   3.7   64   34-106    75-145 (277)
 18 PRK07440 hypothetical protein;  34.0      42 0.00091   22.6   2.5   23   22-44      6-28  (70)
 19 PRK06083 sulfur carrier protei  30.2      70  0.0015   22.5   3.2   23   22-44     20-42  (84)
 20 KOG4224 Armadillo repeat prote  30.1      23 0.00049   32.5   0.8   11    1-11      1-11  (550)
 21 PRK05863 sulfur carrier protei  29.7      55  0.0012   21.5   2.4   22   23-44      3-24  (65)
 22 PRK06437 hypothetical protein;  29.6 1.7E+02  0.0037   19.3   5.3   51   24-81      6-62  (67)
 23 cd01667 TGS_ThrRS_N TGS _ThrRS  27.5   1E+02  0.0022   18.3   3.3   25   21-45      2-26  (61)
 24 PF06200 tify:  tify domain;  I  26.8      47   0.001   19.9   1.5   23   21-43      8-32  (36)
 25 COG2895 CysN GTPases - Sulfate  26.8      33 0.00071   31.2   1.2   65   16-80    264-336 (431)
 26 cd01775 CYR1_RA Ubiquitin doma  25.5      83  0.0018   23.1   2.9   27   19-45      4-32  (97)
 27 PRK08364 sulfur carrier protei  24.8 1.9E+02   0.004   19.2   4.4   49   26-82     10-66  (70)
 28 COG0396 sufC Cysteine desulfur  24.0 2.8E+02   0.006   23.8   6.1   79   22-101    25-108 (251)
 29 cd01616 TGS The TGS domain, na  23.7 1.3E+02  0.0028   17.6   3.3   25   21-45      2-26  (60)
 30 PF08428 Rib:  Rib/alpha-like r  23.2      33 0.00071   22.8   0.4   24   16-39     41-64  (65)
 31 PF11211 DUF2997:  Protein of u  22.0      63  0.0014   20.4   1.5   13   22-34      4-16  (48)
 32 PF02979 NHase_alpha:  Nitrile   20.8      52  0.0011   26.9   1.1   29   73-101   151-180 (188)
 33 PRK07696 sulfur carrier protei  20.2   1E+02  0.0023   20.4   2.4   22   23-44      3-25  (67)

No 1  
>PF14009 DUF4228:  Domain of unknown function (DUF4228)
Probab=100.00  E-value=9.7e-41  Score=261.15  Aligned_cols=105  Identities=39%  Similarity=0.741  Sum_probs=97.4

Q ss_pred             CCCcccCCcCCCCCCCCcceEEEccCCcEEEecCCccHHHHHhhCCCcEEEccCCcccCCcccCCCCCCCCCCCCeEEEE
Q 040603            1 MGNHISCTLSKPLGKHTRSAKVIFPGGEIRQIQTPIKAAELMLEKPNFFLINSRSLKIGQRFSPLNADEDLEPKNVYVMF   80 (172)
Q Consensus         1 MGN~~Sc~~~~~~~~~~~~~kVv~~dG~v~~~~~pv~aaevm~e~P~h~Vc~s~~l~~g~~~~~L~~de~L~~G~~Yfll   80 (172)
                      ||||+||...  ......++||||+||+|++|+.||+|+|||.+||+||||+++.+.+|.++++|++||+|++|++||||
T Consensus         1 MGn~~~~~~~--~~~~~~~vkvv~~~G~v~~~~~pv~a~evm~~~P~h~v~~~~~~~~~~~~~~l~~d~~L~~G~~Y~ll   78 (181)
T PF14009_consen    1 MGNCVSCCLA--SSSSAATVKVVHPDGKVEEFKRPVTAAEVMLENPGHFVCDSDSFRFGRRIKPLPPDEELQPGQIYFLL   78 (181)
T ss_pred             CCCccccccc--ccCCCceEEEEcCCCcEEEeCCCcCHHHHHHHCCCCEEeccccccCCCcccCCCccCeecCCCEEEEE
Confidence            9999998764  12467899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCCCCCCCHHHHHHHHHHHhHhhhh
Q 040603           81 PMKRATSKITATDMATLFVLANKAVKR  107 (172)
Q Consensus        81 P~~~~~~~ls~~~~a~L~~~a~~~~~~  107 (172)
                      |+++++..++..++++++.+++.+...
T Consensus        79 P~~~~~~~~~~~~~~~~~~~~~~~~~~  105 (181)
T PF14009_consen   79 PMSRLQSVLSASDMASLASSASSASSS  105 (181)
T ss_pred             EccccCcccccchhcccccchhhcccc
Confidence            999999999999999999988777664


No 2  
>PF02824 TGS:  TGS domain;  InterPro: IPR004095  The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) []. The TGS domain is also present at the amino terminus of the uridine kinase from the spirochaete Treponema pallidum (but not any other organism, including the related spirochaete Borrelia burgdorferi).  TGS is a small domain that consists of ~50 amino acid residues and is predicted to possess a predominantly beta-sheet structure. There is no direct information on the functions of the TGS domain, but its presence in two types of regulatory proteins (the GTPases and guanosine polyphosphate phosphohydrolases/synthetases) suggests a ligand (most likely nucleotide)-binding, regulatory role []. ; PDB: 1WXQ_A 1NYR_B 1NYQ_B 2KMM_A 1WWT_A 1TKE_A 1TKG_A 1TJE_A 1QF6_A 1TKY_A ....
Probab=78.02  E-value=3.7  Score=26.91  Aligned_cols=25  Identities=16%  Similarity=0.422  Sum_probs=22.5

Q ss_pred             eEEEccCCcEEEecCCccHHHHHhh
Q 040603           20 AKVIFPGGEIRQIQTPIKAAELMLE   44 (172)
Q Consensus        20 ~kVv~~dG~v~~~~~pv~aaevm~e   44 (172)
                      ++|..+||++.+|....|+.|+-..
T Consensus         1 I~v~lpdG~~~~~~~g~T~~d~A~~   25 (60)
T PF02824_consen    1 IRVYLPDGSIKELPEGSTVLDVAYS   25 (60)
T ss_dssp             EEEEETTSCEEEEETTBBHHHHHHH
T ss_pred             CEEECCCCCeeeCCCCCCHHHHHHH
Confidence            5788999999999999999999854


No 3  
>TIGR03793 TOMM_pelo TOMM propeptide domain. This model represents a domain that is conserved among a large number of putative thiazole/oxazole-modified microcins (TOMM). Oddly, most of this seqence region appears homologous to nitrile hydratase subunits. This family is expanded especially in Pelotomaculum thermopropionicum SI.
Probab=77.28  E-value=3.2  Score=29.07  Aligned_cols=25  Identities=16%  Similarity=0.511  Sum_probs=22.4

Q ss_pred             CCCeEEEEecCCCCCCCCHHHHHHHH
Q 040603           73 PKNVYVMFPMKRATSKITATDMATLF   98 (172)
Q Consensus        73 ~G~~YfllP~~~~~~~ls~~~~a~L~   98 (172)
                      +...|++||+..-. .||.+++++++
T Consensus        51 ~~~~~lVlP~~P~~-~lse~~L~~va   75 (77)
T TIGR03793        51 PTVLYLVLPVNPDI-ELTDEQLDAVA   75 (77)
T ss_pred             CCeEEEEecCCCCC-CCCHHHHHHhh
Confidence            67899999999887 89999999876


No 4  
>PF15386 Tantalus:  Drosophila Tantalus-like
Probab=60.21  E-value=5.4  Score=26.86  Aligned_cols=19  Identities=37%  Similarity=0.335  Sum_probs=14.5

Q ss_pred             CCCCCcC-cccccccccccc
Q 040603          153 VSRSKKP-LLETIEEETTYA  171 (172)
Q Consensus       153 ~~r~WkP-~LeTI~E~~~~r  171 (172)
                      +.+.-.+ .||||-|++..+
T Consensus        29 n~k~~~~~~LETIfEEp~~~   48 (61)
T PF15386_consen   29 NYKKPTPKNLETIFEEPKNE   48 (61)
T ss_pred             ccCCCCcCCcchhhcccccc
Confidence            4456666 899999998764


No 5  
>TIGR01323 nitrile_alph nitrile hydratase, alpha subunit. This model describes both iron- and cobalt-containing nitrile hydratase alpha chains. It excludes the thiocyanate hydrolase gamma subunit of Thiobacillus thioparus, a sequence that appears to have evolved from within the family of nitrile hydratase alpha subunits but which differs by several indels and a more rapid accumulation of point mutations.
Probab=50.20  E-value=19  Score=29.25  Aligned_cols=29  Identities=14%  Similarity=0.403  Sum_probs=24.4

Q ss_pred             CCCeEEEEecCCCCCC-CCHHHHHHHHHHH
Q 040603           73 PKNVYVMFPMKRATSK-ITATDMATLFVLA  101 (172)
Q Consensus        73 ~G~~YfllP~~~~~~~-ls~~~~a~L~~~a  101 (172)
                      +...||+||+...... +|.+++++|..+-
T Consensus       145 ae~rYlVLP~RP~gte~lsEeqLa~lVtrd  174 (185)
T TIGR01323       145 AESRYLVLPQRPAGTEHMSEEQLQQLVTRD  174 (185)
T ss_pred             CCeEEEEEecCCCCCCCCCHHHHHHhhccc
Confidence            6789999999987654 9999999998654


No 6  
>PRK08053 sulfur carrier protein ThiS; Provisional
Probab=49.48  E-value=63  Score=21.18  Aligned_cols=22  Identities=18%  Similarity=0.113  Sum_probs=19.4

Q ss_pred             EccCCcEEEecCCccHHHHHhh
Q 040603           23 IFPGGEIRQIQTPIKAAELMLE   44 (172)
Q Consensus        23 v~~dG~v~~~~~pv~aaevm~e   44 (172)
                      |.-||+..++..++|+++|+.+
T Consensus         3 i~vNg~~~~~~~~~tl~~ll~~   24 (66)
T PRK08053          3 ILFNDQPMQCAAGQTVHELLEQ   24 (66)
T ss_pred             EEECCeEEEcCCCCCHHHHHHH
Confidence            5669999999999999999963


No 7  
>PRK00994 F420-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional
Probab=49.38  E-value=58  Score=27.95  Aligned_cols=78  Identities=18%  Similarity=0.222  Sum_probs=54.3

Q ss_pred             CcceEEEccCCcEEEecCCccHHHHHhhC--CCcEEEccCCcccCCcccCCCCCCCCC-CCCeEEEEecCCCC---CC-C
Q 040603           17 TRSAKVIFPGGEIRQIQTPIKAAELMLEK--PNFFLINSRSLKIGQRFSPLNADEDLE-PKNVYVMFPMKRAT---SK-I   89 (172)
Q Consensus        17 ~~~~kVv~~dG~v~~~~~pv~aaevm~e~--P~h~Vc~s~~l~~g~~~~~L~~de~L~-~G~~YfllP~~~~~---~~-l   89 (172)
                      +..+-||-||+.   ...|..|.|++.+.  |--+|.|.-..+         ..++|+ .|.=|++++.+..-   +. |
T Consensus        61 pDf~i~isPN~a---~PGP~~ARE~l~~~~iP~IvI~D~p~~K---------~~d~l~~~g~GYIivk~DpMIGArREFL  128 (277)
T PRK00994         61 PDFVIVISPNPA---APGPKKAREILKAAGIPCIVIGDAPGKK---------VKDAMEEQGLGYIIVKADPMIGARREFL  128 (277)
T ss_pred             CCEEEEECCCCC---CCCchHHHHHHHhcCCCEEEEcCCCccc---------hHHHHHhcCCcEEEEecCccccchhhcc
Confidence            345666677764   46789999999866  776775553322         234454 78889999998753   23 9


Q ss_pred             CHHHHHHHHHHHhHhhh
Q 040603           90 TATDMATLFVLANKAVK  106 (172)
Q Consensus        90 s~~~~a~L~~~a~~~~~  106 (172)
                      .+.||+.+....-+.+.
T Consensus       129 DP~EMa~fNaD~~kVLa  145 (277)
T PRK00994        129 DPVEMALFNADVLKVLA  145 (277)
T ss_pred             CHHHHHHhhhhHHHHHH
Confidence            99999999876655554


No 8  
>cd00178 STI Soybean trypsin inhibitor (Kunitz) family of protease inhibitors. Inhibit proteases by binding with high affinity to their active sites. Trefoil fold, common to interleukins and fibroblast growth factors.
Probab=48.62  E-value=14  Score=29.28  Aligned_cols=19  Identities=21%  Similarity=0.387  Sum_probs=16.9

Q ss_pred             CCCCCCCCCeEEEEecCCC
Q 040603           67 ADEDLEPKNVYVMFPMKRA   85 (172)
Q Consensus        67 ~de~L~~G~~YfllP~~~~   85 (172)
                      .+++|+.|.-||++|..+.
T Consensus         6 ~G~~l~~g~~YyI~p~~~g   24 (172)
T cd00178           6 DGNPLRNGGRYYILPAIRG   24 (172)
T ss_pred             CCCCCcCCCeEEEEEceeC
Confidence            4789999999999999874


No 9  
>cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response. RelA contains a TGS domain, named after the Threonyl-tRNA Synthetase, GTPase, and SpoT proteins where it occurs.  The function of the TGS domain is unknown.
Probab=48.59  E-value=25  Score=21.83  Aligned_cols=23  Identities=22%  Similarity=0.378  Sum_probs=20.2

Q ss_pred             EEccCCcEEEecCCccHHHHHhh
Q 040603           22 VIFPGGEIRQIQTPIKAAELMLE   44 (172)
Q Consensus        22 Vv~~dG~v~~~~~pv~aaevm~e   44 (172)
                      |..+||...++..+++++++...
T Consensus         3 ~~~~~g~~~~~~~~~t~~~~~~~   25 (60)
T cd01668           3 VFTPKGEIIELPAGATVLDFAYA   25 (60)
T ss_pred             EECCCCCEEEcCCCCCHHHHHHH
Confidence            56789999999999999998853


No 10 
>PF00197 Kunitz_legume:  Trypsin and protease inhibitor;  InterPro: IPR002160 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  The Kunitz-type soybean trypsin inhibitor (STI) family consists mainly of proteinase inhibitors from Leguminosae seeds []. They belong to MEROPS inhibitor family I3, clan IC. They exhibit proteinase inhibitory activity against serine proteinases; trypsin (MEROPS peptidase family S1, IPR001254 from INTERPRO) and subtilisin (MEROPS peptidase family S8, IPR000209 from INTERPRO), thiol proteinases (MEROPS peptidase family C1, IPR000668 from INTERPRO) and aspartic proteinases (MEROPS peptidase family A1, IPR001461 from INTERPRO) [].  Inhibitors from cereals are active against subtilisin and endogenous alpha-amylases, while some also inhibit tissue plasminogen activator. The inhibitors are usually specific for either trypsin or chymotrypsin, and some are effective against both. They are thought to protect the seeds against consumption by animal predators, while at the same time existing as seed storage proteins themselves - all the actively inhibitory members contain 2 disulphide bridges. The existence of a member with no inhibitory activity, winged bean albumin 1, suggests that the inhibitors may have evolved from seed storage proteins. Proteins from the Kunitz family contain from 170 to 200 amino acid residues and one or two intra-chain disulphide bonds. The best conserved region is found in their N-terminal section. The crystal structures of soybean trypsin inhibitor (STI), trypsin inhibitor DE-3 from the Kaffir tree Erythrina caffra (ETI) [] and the bifunctional proteinase K/alpha-amylase inhibitor from wheat (PK13) have been solved, showing them to share the same 12-stranded beta-sheet structure as those of interleukin-1 and heparin-binding growth factors []. The beta-sheets are arranged in 3 similar lobes around a central axis, 6 strands forming an anti-parallel beta-barrel. Despite the structural similarity, STI shows no interleukin-1 bioactivity, presumably as a result of their primary sequence disparities. The active inhibitory site containing the scissile bond is located in the loop between beta-strands 4 and 5 in STI and ETI. The STIs belong to a superfamily that also contains the interleukin-1 proteins, heparin binding growth factors (HBGF) and histactophilin, all of which have very similar structures, but share no sequence similarity with the STI family.; GO: 0004866 endopeptidase inhibitor activity; PDB: 3TC2_B 3S8J_A 3S8K_A 1TIE_A 2GZB_A 3E8L_C 2IWT_B 3BX1_C 1AVA_D 3IIR_A ....
Probab=45.47  E-value=19  Score=28.66  Aligned_cols=20  Identities=20%  Similarity=0.380  Sum_probs=16.3

Q ss_pred             CCCCCCCCCeEEEEecCCCC
Q 040603           67 ADEDLEPKNVYVMFPMKRAT   86 (172)
Q Consensus        67 ~de~L~~G~~YfllP~~~~~   86 (172)
                      .+++|++|.-||++|..+..
T Consensus         6 ~G~~l~~g~~YyI~p~~~~~   25 (176)
T PF00197_consen    6 DGNPLRNGGEYYILPAIRGA   25 (176)
T ss_dssp             TSCB-BTTSEEEEEESSTGC
T ss_pred             CCCCCcCCCCEEEEeCccCC
Confidence            47889999999999987765


No 11 
>PRK05659 sulfur carrier protein ThiS; Validated
Probab=45.39  E-value=21  Score=23.18  Aligned_cols=22  Identities=27%  Similarity=0.311  Sum_probs=19.8

Q ss_pred             EccCCcEEEecCCccHHHHHhh
Q 040603           23 IFPGGEIRQIQTPIKAAELMLE   44 (172)
Q Consensus        23 v~~dG~v~~~~~pv~aaevm~e   44 (172)
                      |..||+..++..+.|+++++..
T Consensus         3 i~vNG~~~~~~~~~tl~~lL~~   24 (66)
T PRK05659          3 IQLNGEPRELPDGESVAALLAR   24 (66)
T ss_pred             EEECCeEEEcCCCCCHHHHHHh
Confidence            5679999999999999999964


No 12 
>PRK06944 sulfur carrier protein ThiS; Provisional
Probab=44.83  E-value=82  Score=20.18  Aligned_cols=54  Identities=13%  Similarity=0.128  Sum_probs=33.1

Q ss_pred             EccCCcEEEecCCccHHHHHhhC---CCcEEEccCCcccCCccc-CCCCCCCCCCCCeEEEEe
Q 040603           23 IFPGGEIRQIQTPIKAAELMLEK---PNFFLINSRSLKIGQRFS-PLNADEDLEPKNVYVMFP   81 (172)
Q Consensus        23 v~~dG~v~~~~~pv~aaevm~e~---P~h~Vc~s~~l~~g~~~~-~L~~de~L~~G~~YfllP   81 (172)
                      |..||+..++....|++|++...   |+..| .    ..|.-++ .-..+..|+.|-..-++|
T Consensus         3 i~vNg~~~~~~~~~tl~~ll~~l~~~~~~~v-~----vN~~~v~~~~~~~~~L~~gD~vei~~   60 (65)
T PRK06944          3 IQLNQQTLSLPDGATVADALAAYGARPPFAV-A----VNGDFVARTQHAARALAAGDRLDLVQ   60 (65)
T ss_pred             EEECCEEEECCCCCcHHHHHHhhCCCCCeEE-E----ECCEEcCchhcccccCCCCCEEEEEe
Confidence            56699999999999999999643   33322 1    1122222 134466677775555555


No 13 
>TIGR01683 thiS thiamine biosynthesis protein ThiS. This model represents ThiS, a small thiamine-biosynthesis protein related to MoaD, a molybdenum cofactor biosynthesis protein. Both proteins are involved in sulfur transfer. ThiS has a conserved Gly-Gly C-terminus that is modified, in reactions requiring ThiI, ThiF, IscS, and a sulfur atom from Cys, into the thiocarboxylate that provides the sulfur for thiazole biosynthesis.
Probab=44.00  E-value=69  Score=20.75  Aligned_cols=55  Identities=15%  Similarity=0.124  Sum_probs=32.7

Q ss_pred             EccCCcEEEecCCccHHHHHhhC---CCcEEEccCCcccCCcccC-CCCCCCCCCCCeEEEEe
Q 040603           23 IFPGGEIRQIQTPIKAAELMLEK---PNFFLINSRSLKIGQRFSP-LNADEDLEPKNVYVMFP   81 (172)
Q Consensus        23 v~~dG~v~~~~~pv~aaevm~e~---P~h~Vc~s~~l~~g~~~~~-L~~de~L~~G~~YfllP   81 (172)
                      |.-||+..++..++|++||+.+.   |..++..-+.    .-++. -..+..|+.|-..-++|
T Consensus         1 i~iNg~~~~~~~~~tv~~ll~~l~~~~~~v~v~vN~----~iv~~~~~~~~~L~~gD~veii~   59 (64)
T TIGR01683         1 ITVNGEPVEVEDGLTLAALLESLGLDPRRVAVAVNG----EIVPRSEWDDTILKEGDRIEIVT   59 (64)
T ss_pred             CEECCeEEEcCCCCcHHHHHHHcCCCCCeEEEEECC----EEcCHHHcCceecCCCCEEEEEE
Confidence            34689999999999999999754   4444322221    11111 13345676665555555


No 14 
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein. ThiS (ThiaminS) is a sulfur carrier protein involved in thiamin biosynthesis in bacteria.  The ThiS fold, like those of two closely related proteins MoaD and Urm1, is similar to that of ubiquitin although there is little or no sequence similarity.
Probab=38.81  E-value=56  Score=21.21  Aligned_cols=23  Identities=35%  Similarity=0.394  Sum_probs=19.6

Q ss_pred             EccCCcEEEecCCccHHHHHhhC
Q 040603           23 IFPGGEIRQIQTPIKAAELMLEK   45 (172)
Q Consensus        23 v~~dG~v~~~~~pv~aaevm~e~   45 (172)
                      |.-||+..++..+.|+.+|+.+.
T Consensus         2 i~iNg~~~~~~~~~tv~~ll~~l   24 (65)
T cd00565           2 ITVNGEPREVEEGATLAELLEEL   24 (65)
T ss_pred             EEECCeEEEcCCCCCHHHHHHHc
Confidence            45689999999999999999644


No 15 
>smart00452 STI Soybean trypsin inhibitor (Kunitz) family of protease inhibitors.
Probab=37.35  E-value=27  Score=27.80  Aligned_cols=19  Identities=21%  Similarity=0.422  Sum_probs=16.6

Q ss_pred             CCCCCCCCCeEEEEecCCC
Q 040603           67 ADEDLEPKNVYVMFPMKRA   85 (172)
Q Consensus        67 ~de~L~~G~~YfllP~~~~   85 (172)
                      .+++|+.|.-||++|..+.
T Consensus         5 ~G~~l~~G~~YyI~p~~~g   23 (172)
T smart00452        5 DGNPLRNGGTYYILPAIRG   23 (172)
T ss_pred             CCCCCcCCCcEEEEEcccc
Confidence            4789999999999999764


No 16 
>PF08140 Cuticle_1:  Crustacean cuticle protein repeat;  InterPro: IPR012539 This family consists of the cuticle proteins from the Cancer pagurus (Rock crab) and the Homarus americanus (American lobster). These proteins are isolated from the calcified regions of the crustacean and they contain two copies of an 18 residue sequence motif, which thus far has been found only in crustacean calcified exoskeletons [].; GO: 0042302 structural constituent of cuticle
Probab=36.79  E-value=20  Score=22.20  Aligned_cols=27  Identities=22%  Similarity=0.333  Sum_probs=20.6

Q ss_pred             EEccCCcEEEecCCccHHHHHhhCCCcEE
Q 040603           22 VIFPGGEIRQIQTPIKAAELMLEKPNFFL   50 (172)
Q Consensus        22 Vv~~dG~v~~~~~pv~aaevm~e~P~h~V   50 (172)
                      +|++||+.++|...+.  +|.+.-|.-.|
T Consensus         5 ii~~dG~~~q~~~~~a--~ivl~GpSG~v   31 (40)
T PF08140_consen    5 IITPDGTNVQFPHGVA--NIVLIGPSGAV   31 (40)
T ss_pred             eECCCCCEEECCcccc--eEEEECCceEE
Confidence            7899999999998874  66666665443


No 17 
>COG1927 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase [Energy production and conversion]
Probab=35.84  E-value=53  Score=27.80  Aligned_cols=64  Identities=19%  Similarity=0.323  Sum_probs=44.5

Q ss_pred             CCccHHHHHh--hCCCcEEEccCCcccCCcccCCCCCCCC-CCCCeEEEEecCCCC---CC-CCHHHHHHHHHHHhHhhh
Q 040603           34 TPIKAAELML--EKPNFFLINSRSLKIGQRFSPLNADEDL-EPKNVYVMFPMKRAT---SK-ITATDMATLFVLANKAVK  106 (172)
Q Consensus        34 ~pv~aaevm~--e~P~h~Vc~s~~l~~g~~~~~L~~de~L-~~G~~YfllP~~~~~---~~-ls~~~~a~L~~~a~~~~~  106 (172)
                      .|.+|.|++.  +.|--+|.++-.+         ..-++| +-|-=|.+++.+..-   +. |.+.|||.+...+-..+.
T Consensus        75 GP~kARE~l~~s~~PaiiigDaPg~---------~vkdeleeqGlGYIivk~DpmiGArREFLDPvEMA~fNaDv~kVLa  145 (277)
T COG1927          75 GPKKAREILSDSDVPAIIIGDAPGL---------KVKDELEEQGLGYIIVKADPMIGARREFLDPVEMASFNADVMKVLA  145 (277)
T ss_pred             CchHHHHHHhhcCCCEEEecCCccc---------hhHHHHHhcCCeEEEecCCcccchhhhhcCHHHHHhhhhHHHHHHH
Confidence            5778888887  6677666555433         333444 588899999988653   23 999999999876555444


No 18 
>PRK07440 hypothetical protein; Provisional
Probab=34.00  E-value=42  Score=22.60  Aligned_cols=23  Identities=17%  Similarity=0.296  Sum_probs=19.9

Q ss_pred             EEccCCcEEEecCCccHHHHHhh
Q 040603           22 VIFPGGEIRQIQTPIKAAELMLE   44 (172)
Q Consensus        22 Vv~~dG~v~~~~~pv~aaevm~e   44 (172)
                      -|.-||+..++..++|+.+|+.+
T Consensus         6 ~i~vNG~~~~~~~~~tl~~lL~~   28 (70)
T PRK07440          6 TLQVNGETRTCSSGTSLPDLLQQ   28 (70)
T ss_pred             EEEECCEEEEcCCCCCHHHHHHH
Confidence            35569999999999999999964


No 19 
>PRK06083 sulfur carrier protein ThiS; Provisional
Probab=30.18  E-value=70  Score=22.50  Aligned_cols=23  Identities=13%  Similarity=0.149  Sum_probs=20.2

Q ss_pred             EEccCCcEEEecCCccHHHHHhh
Q 040603           22 VIFPGGEIRQIQTPIKAAELMLE   44 (172)
Q Consensus        22 Vv~~dG~v~~~~~pv~aaevm~e   44 (172)
                      -|.-||+..+++.++++++|+.+
T Consensus        20 ~I~VNG~~~~~~~~~tl~~LL~~   42 (84)
T PRK06083         20 TISINDQSIQVDISSSLAQIIAQ   42 (84)
T ss_pred             EEEECCeEEEcCCCCcHHHHHHH
Confidence            36779999999999999999964


No 20 
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport]
Probab=30.15  E-value=23  Score=32.49  Aligned_cols=11  Identities=55%  Similarity=0.875  Sum_probs=9.0

Q ss_pred             CCCcccCCcCC
Q 040603            1 MGNHISCTLSK   11 (172)
Q Consensus         1 MGN~~Sc~~~~   11 (172)
                      ||||.||+-.+
T Consensus         1 MG~c~sc~~~S   11 (550)
T KOG4224|consen    1 MGNCLSCCESS   11 (550)
T ss_pred             CCccccccccc
Confidence            99999997553


No 21 
>PRK05863 sulfur carrier protein ThiS; Provisional
Probab=29.69  E-value=55  Score=21.49  Aligned_cols=22  Identities=14%  Similarity=0.170  Sum_probs=19.4

Q ss_pred             EccCCcEEEecCCccHHHHHhh
Q 040603           23 IFPGGEIRQIQTPIKAAELMLE   44 (172)
Q Consensus        23 v~~dG~v~~~~~pv~aaevm~e   44 (172)
                      |.-||+..++..+.|+.|++.+
T Consensus         3 i~vNG~~~~~~~~~tl~~ll~~   24 (65)
T PRK05863          3 VVVNEEQVEVDEQTTVAALLDS   24 (65)
T ss_pred             EEECCEEEEcCCCCcHHHHHHH
Confidence            4569999999999999999964


No 22 
>PRK06437 hypothetical protein; Provisional
Probab=29.61  E-value=1.7e+02  Score=19.33  Aligned_cols=51  Identities=10%  Similarity=0.270  Sum_probs=30.7

Q ss_pred             ccCC---cEEEecCCccHHHHHhhC---CCcEEEccCCcccCCcccCCCCCCCCCCCCeEEEEe
Q 040603           24 FPGG---EIRQIQTPIKAAELMLEK---PNFFLINSRSLKIGQRFSPLNADEDLEPKNVYVMFP   81 (172)
Q Consensus        24 ~~dG---~v~~~~~pv~aaevm~e~---P~h~Vc~s~~l~~g~~~~~L~~de~L~~G~~YfllP   81 (172)
                      .-+|   +..++..+.|++||+.+.   |..++.-    ..|.   .++.|..|..|--.-++|
T Consensus         6 ~v~g~~~~~~~i~~~~tv~dLL~~Lgi~~~~vaV~----vNg~---iv~~~~~L~dgD~Veiv~   62 (67)
T PRK06437          6 RVKGHINKTIEIDHELTVNDIIKDLGLDEEEYVVI----VNGS---PVLEDHNVKKEDDVLILE   62 (67)
T ss_pred             EecCCcceEEEcCCCCcHHHHHHHcCCCCccEEEE----ECCE---ECCCceEcCCCCEEEEEe
Confidence            3457   557778889999999643   3333322    1122   233788888876555555


No 23 
>cd01667 TGS_ThrRS_N TGS _ThrRS_N:  ThrRS (threonyl-tRNA Synthetase)  is a class II tRNA synthetase that couples threonine to its cognate tRNA.  In addition to its catalytic and anticodon-binding domains, ThrRS has an N-terminal TGS domain, named after the ThrRS, GTPase, and SpoT proteins where it occurs. The TGS domain is thought to interact with the tRNA acceptor arm along with an adjacent N-terminal domain. The specific function of TGS is not well understood.
Probab=27.50  E-value=1e+02  Score=18.29  Aligned_cols=25  Identities=12%  Similarity=0.380  Sum_probs=21.0

Q ss_pred             EEEccCCcEEEecCCccHHHHHhhC
Q 040603           21 KVIFPGGEIRQIQTPIKAAELMLEK   45 (172)
Q Consensus        21 kVv~~dG~v~~~~~pv~aaevm~e~   45 (172)
                      ++..++|...++..+++..++..+.
T Consensus         2 ~i~~~~~~~~~~~~~~t~~~~~~~~   26 (61)
T cd01667           2 KITLPDGSVKEFPKGTTPLDIAKSI   26 (61)
T ss_pred             EEEcCCCCEEEeCCCCCHHHHHHHH
Confidence            5677899999999999999988654


No 24 
>PF06200 tify:  tify domain;  InterPro: IPR010399 The tify domain is a 36-amino acid domain only found among Embryophyta (land plants). It has been named after the most conserved amino acid pattern (TIF[F/Y]XG) it contains, but was previously known as the Zim domain. As the use of uppercase characters (TIFY) might imply that the domain is fully conserved across proteins, a lowercase lettering has been chosen in an attempt to highlight the reality of its natural variability.  Based on the domain architecture, tify domain containing proteins can be classified into two groups. Group I is formed by proteins possessing a CCT (CONSTANS, CO-like, and TOC1) domain and a GATA-type zinc finger in addition to the tify domain. Group II contains proteins characterised by the tify domain but lacking a GATA-type zinc finger. Tify domain containing proteins might be involved in developmental processes and some of them have features that are characteristic for transcription factors: a nuclear localisation and the presence of a putative DNA-binding domain []. Some proteins known to contain a tify domain include:   Arabidopsis thaliana Zinc-finger protein expressed in Inflorescence Meristem (ZIM), a putative transcription factor involved in inflorescence and flower development [, ].  A. thaliana ZIM-like proteins (ZML) [].  A. thaliana PEAPOD1 and PEAPOD2 (PPD1 and PPD2) [].   
Probab=26.77  E-value=47  Score=19.92  Aligned_cols=23  Identities=43%  Similarity=0.667  Sum_probs=18.5

Q ss_pred             EEEccCCcEEEec--CCccHHHHHh
Q 040603           21 KVIFPGGEIRQIQ--TPIKAAELML   43 (172)
Q Consensus        21 kVv~~dG~v~~~~--~pv~aaevm~   43 (172)
                      --|+-+|+|.-|.  .|-+|.+||.
T Consensus         8 LTIfY~G~V~Vfd~v~~~Ka~~im~   32 (36)
T PF06200_consen    8 LTIFYGGQVCVFDDVPPDKAQEIML   32 (36)
T ss_pred             EEEEECCEEEEeCCCCHHHHHHHHH
Confidence            3467799999998  3678999995


No 25 
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]
Probab=26.76  E-value=33  Score=31.21  Aligned_cols=65  Identities=14%  Similarity=0.249  Sum_probs=38.9

Q ss_pred             CCcceEEEccCCcEEEecCCccHHHHHhh----CCCcEEEccCC-cccCCccc--CCC-CCCCCCCCCeEEEE
Q 040603           16 HTRSAKVIFPGGEIRQIQTPIKAAELMLE----KPNFFLINSRS-LKIGQRFS--PLN-ADEDLEPKNVYVMF   80 (172)
Q Consensus        16 ~~~~~kVv~~dG~v~~~~~pv~aaevm~e----~P~h~Vc~s~~-l~~g~~~~--~L~-~de~L~~G~~Yfll   80 (172)
                      .....+|+.+||.+.+....-.+.=++.+    .-|-++|+.+. ......+.  .++ +++.|+||+-|.|=
T Consensus       264 ~s~V~~Ivt~dg~~~~A~aG~aVtl~L~deidisRGd~i~~~~~~~~~~~~f~A~vvWm~~~pl~pGr~Y~lK  336 (431)
T COG2895         264 TSRVKRIVTFDGELAQASAGEAVTLVLADEIDISRGDLIVAADAPPAVADAFDADVVWMDEEPLLPGRSYDLK  336 (431)
T ss_pred             eeeEEEEeccCCchhhccCCceEEEEEcceeecccCcEEEccCCCcchhhhcceeEEEecCCCCCCCceEEEE
Confidence            45677888888888887765433323322    13566666553 22222222  223 57889999999983


No 26 
>cd01775 CYR1_RA Ubiquitin domain of CYR1 adenylate cyclase. CYR1 is a fungal adenylate cyclase with at least four domains, an N-terminal RA (Ras association) domain, a middle leucine-rich repeat domain, a catalytic domain.   The N-terminal RA domain of CYR1 post-translationally modifies a small GTPase called Ras. The Ras-CYR1 pathway has been implicated in the transduction of a glucose-triggered signal to an intracellular environment where a protein phosphorylation cascade is initiated by cyclic AMP.
Probab=25.46  E-value=83  Score=23.07  Aligned_cols=27  Identities=19%  Similarity=0.362  Sum_probs=23.0

Q ss_pred             ceEEEccCCcEEEecCC--ccHHHHHhhC
Q 040603           19 SAKVIFPGGEIRQIQTP--IKAAELMLEK   45 (172)
Q Consensus        19 ~~kVv~~dG~v~~~~~p--v~aaevm~e~   45 (172)
                      .+||-..||+-.-+.-|  +||+||+..-
T Consensus         4 ~IRIFr~D~Tf~Tls~~l~tTv~eli~~L   32 (97)
T cd01775           4 CIRVFRSDGTFTTLSCPLNTTVSELIPQL   32 (97)
T ss_pred             EEEEEecCCcEEEEEcCCcCcHHHHHHHH
Confidence            68999999998888876  6999999644


No 27 
>PRK08364 sulfur carrier protein ThiS; Provisional
Probab=24.81  E-value=1.9e+02  Score=19.16  Aligned_cols=49  Identities=12%  Similarity=0.152  Sum_probs=30.2

Q ss_pred             CCc----EEEecCCccHHHHHhhC--C-Cc-EEEccCCcccCCcccCCCCCCCCCCCCeEEEEec
Q 040603           26 GGE----IRQIQTPIKAAELMLEK--P-NF-FLINSRSLKIGQRFSPLNADEDLEPKNVYVMFPM   82 (172)
Q Consensus        26 dG~----v~~~~~pv~aaevm~e~--P-~h-~Vc~s~~l~~g~~~~~L~~de~L~~G~~YfllP~   82 (172)
                      +|+    ..++....|++||+.+.  + .. .|..-     |   ..+++|..|+.|--.-++|.
T Consensus        10 ng~~~~~~~~~~~~~tv~~ll~~l~~~~~~v~v~vN-----g---~iv~~~~~l~~gD~Veii~~   66 (70)
T PRK08364         10 IGRGIEKEIEWRKGMKVADILRAVGFNTESAIAKVN-----G---KVALEDDPVKDGDYVEVIPV   66 (70)
T ss_pred             eccccceEEEcCCCCcHHHHHHHcCCCCccEEEEEC-----C---EECCCCcCcCCCCEEEEEcc
Confidence            666    55667889999999643  2 22 22211     1   12356888888877777663


No 28 
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=24.02  E-value=2.8e+02  Score=23.77  Aligned_cols=79  Identities=19%  Similarity=0.274  Sum_probs=58.8

Q ss_pred             EEccCCcEEEecCC-----ccHHHHHhhCCCcEEEccCCcccCCcccCCCCCCCCCCCCeEEEEecCCCCCCCCHHHHHH
Q 040603           22 VIFPGGEIRQIQTP-----IKAAELMLEKPNFFLINSRSLKIGQRFSPLNADEDLEPKNVYVMFPMKRATSKITATDMAT   96 (172)
Q Consensus        22 Vv~~dG~v~~~~~p-----v~aaevm~e~P~h~Vc~s~~l~~g~~~~~L~~de~L~~G~~YfllP~~~~~~~ls~~~~a~   96 (172)
                      +--..|++..+=.|     -|-+.++..+|+|=|...+-++-|..+.-|++||.-+.|- ++.+-.+.--+-++..+.-+
T Consensus        25 L~v~~GEvhaiMGPNGsGKSTLa~~i~G~p~Y~Vt~G~I~~~GedI~~l~~~ERAr~Gi-fLafQ~P~ei~GV~~~~fLr  103 (251)
T COG0396          25 LTVKEGEVHAIMGPNGSGKSTLAYTIMGHPKYEVTEGEILFDGEDILELSPDERARAGI-FLAFQYPVEIPGVTNSDFLR  103 (251)
T ss_pred             eeEcCCcEEEEECCCCCCHHHHHHHHhCCCCceEecceEEECCcccccCCHhHHHhcCC-EEeecCCccCCCeeHHHHHH
Confidence            33345666555544     5888999999999999999999999999999999999984 44444444444577777777


Q ss_pred             HHHHH
Q 040603           97 LFVLA  101 (172)
Q Consensus        97 L~~~a  101 (172)
                      .+..+
T Consensus       104 ~a~n~  108 (251)
T COG0396         104 AAMNA  108 (251)
T ss_pred             HHHHh
Confidence            76665


No 29 
>cd01616 TGS The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin. TGS is a small domain of about 50 amino acid residues with a predominantly beta-sheet structure. There is no direct information on the function of the TGS domain, but its presence in two types of regulatory proteins (the GTPases and guanosine polyphosphate phosphohydrolases/synthetases) suggests a ligand (most likely nucleotide)-binding, regulatory role.
Probab=23.73  E-value=1.3e+02  Score=17.62  Aligned_cols=25  Identities=16%  Similarity=0.300  Sum_probs=20.6

Q ss_pred             EEEccCCcEEEecCCccHHHHHhhC
Q 040603           21 KVIFPGGEIRQIQTPIKAAELMLEK   45 (172)
Q Consensus        21 kVv~~dG~v~~~~~pv~aaevm~e~   45 (172)
                      .++..||...++....++.++..+.
T Consensus         2 ~~~~~~~~~~~~~~g~t~~~~~~~~   26 (60)
T cd01616           2 IIFTPDGSAVELPKGATAMDFALKI   26 (60)
T ss_pred             EEECCCCCEEEcCCCCCHHHHHHHH
Confidence            4677889999999999999988644


No 30 
>PF08428 Rib:  Rib/alpha-like repeat;  InterPro: IPR012706 This entry represents a region of about 79 amino acids found tandemly repeated up to fourteen times within the proteins that contain it. The repeats lack cysteines and are highly conserved, even at the DNA level, within and between proteins []. Proteins containing these repeats include the Rib and alpha surface antigens of group B Streptococcus, Esp of Enterococcus faecalis (Streptococcus faecalis), and related proteins of Lactobacillus. Most members of this protein family also have the cell wall anchor motif, LPXTG, shared by many staphyloccal and streptococcal surface antigens. These repeats are thought to define protective epitopes and may play a role in generating phenotypic and genotypic variation [].
Probab=23.23  E-value=33  Score=22.84  Aligned_cols=24  Identities=25%  Similarity=0.599  Sum_probs=19.5

Q ss_pred             CCcceEEEccCCcEEEecCCccHH
Q 040603           16 HTRSAKVIFPGGEIRQIQTPIKAA   39 (172)
Q Consensus        16 ~~~~~kVv~~dG~v~~~~~pv~aa   39 (172)
                      ....++|-++||...+..-+++|.
T Consensus        41 ~~~~V~VtypDgS~~~V~v~V~V~   64 (65)
T PF08428_consen   41 KTGKVKVTYPDGSTDEVPVPVTVT   64 (65)
T ss_pred             EEEEEEEEcCCCCEEEEEeEEEEe
Confidence            355789999999999998887653


No 31 
>PF11211 DUF2997:  Protein of unknown function (DUF2997);  InterPro: IPR021375  This family of proteins has no known function. 
Probab=21.97  E-value=63  Score=20.45  Aligned_cols=13  Identities=23%  Similarity=0.634  Sum_probs=9.4

Q ss_pred             EEccCCcEEEecC
Q 040603           22 VIFPGGEIRQIQT   34 (172)
Q Consensus        22 Vv~~dG~v~~~~~   34 (172)
                      .|++||+|++=..
T Consensus         4 ~I~~dG~V~~~v~   16 (48)
T PF11211_consen    4 TIYPDGRVEEEVE   16 (48)
T ss_pred             EECCCcEEEEEEE
Confidence            4688999887543


No 32 
>PF02979 NHase_alpha:  Nitrile hydratase, alpha chain;  InterPro: IPR004232 Nitrile hydratases (4.2.1.84 from EC) are bacterial enzymes that catalyse the hydration of nitrile compounds to the corresponding amides. They are used as biocatalysts in acrylamide production, one of the few commercial scale bioprocesses, as well as in environmental remediation for the removal of nitriles from waste streams. Nitrile hydratases are composed of two subunits, alpha and beta, and are normally active as a tetramer, alpha(2)beta(2). Nitrile hydratases contain either a non-haem iron or a non-corrinoid cobalt centre, both types sharing a highly conserved peptide sequence in the alpha subunit (CXLCSC) that provides all the residues involved in coordinating the metal ion. Each type of nitrile hydratase specifically incorporated its metal with the help of activator proteins encoded by flanking regions of the nitrile hydratase genes that are necessary for metal insertion. The Fe-containing enzyme is photo-regulated: in the dark the enzyme is inactivated due to the association of nitric oxide (NO) to the iron, while in the light the enzyme is active by photo-dissociation of NO. The NO is held in place by a claw setting formed through specific oxygen atoms in two modified cysteines and a serine residue in the active site [, ]. The cobalt-containing enzyme is unaffected by NO, but was shown to undergo a similar effect with carbon monoxide [, ]. Fe- and cobalt-containing enzymes also display different inhibition patterns with nitrophenols. Thiocyanate hydrolase (SCNase) is a cobalt-containing metalloenzyme with a cysteine-sulphinic acid ligand that hydrolyses thiocyanate to carbonyl sulphide and ammonia []. The two enzymes, nitrile hydratase and SCNase, are homologous over regions corresponding to almost the entire coding regions of the genes: the beta and alpha subunits of thiocyanate hydrolase were homologous to the amino- and carboxyl-terminal halves of the beta subunit of nitrile hydratase, and the gamma subunit of thiocyanate hydrolase was homologous to the alpha subunit of nitrile hydratase [].  This entry represents the structural domain of the alpha subunit of both iron- and cobalt-containing nitrile hydratases; the alpha subunit is a duplication of two structural repeats, each consisting of 4 layers, alpha/beta/beta/alpha []. This structure is also found in the related protein, the gamma subunit of thiocyanate hydrolase (SCNase).; GO: 0003824 catalytic activity, 0046914 transition metal ion binding, 0006807 nitrogen compound metabolic process; PDB: 2DPP_A 3HHT_A 1V29_A 2ZZD_I 2DXC_F 2DXB_F 2DD5_C 2DD4_C 2ZPH_A 2CYZ_A ....
Probab=20.80  E-value=52  Score=26.93  Aligned_cols=29  Identities=21%  Similarity=0.416  Sum_probs=16.6

Q ss_pred             CCCeEEEEecCCCCCC-CCHHHHHHHHHHH
Q 040603           73 PKNVYVMFPMKRATSK-ITATDMATLFVLA  101 (172)
Q Consensus        73 ~G~~YfllP~~~~~~~-ls~~~~a~L~~~a  101 (172)
                      +...|++||+..-... +|.++++.|..+-
T Consensus       151 a~~rylVLP~rP~gte~~see~La~lVtrd  180 (188)
T PF02979_consen  151 AEVRYLVLPMRPAGTEGWSEEQLAALVTRD  180 (188)
T ss_dssp             SSEEEEEE----TT-TT--HHHHHCTS-HH
T ss_pred             cceEEEEecCCCCCCCCCCHHHHHHHhccc
Confidence            4568999999987654 9999999887554


No 33 
>PRK07696 sulfur carrier protein ThiS; Provisional
Probab=20.21  E-value=1e+02  Score=20.36  Aligned_cols=22  Identities=18%  Similarity=0.235  Sum_probs=18.4

Q ss_pred             EccCCcEEEecCC-ccHHHHHhh
Q 040603           23 IFPGGEIRQIQTP-IKAAELMLE   44 (172)
Q Consensus        23 v~~dG~v~~~~~p-v~aaevm~e   44 (172)
                      |.-||+..++..+ .|++|++.+
T Consensus         3 I~vNG~~~~~~~~~~tv~~lL~~   25 (67)
T PRK07696          3 LKINGNQIEVPESVKTVAELLTH   25 (67)
T ss_pred             EEECCEEEEcCCCcccHHHHHHH
Confidence            4569999999987 789999963


Done!