BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 040608
         (314 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q6FR37|CTM1_CANGA Cytochrome c lysine N-methyltransferase 1 OS=Candida glabrata
           (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 /
           NRRL Y-65) GN=CTM1 PE=3 SV=1
          Length = 551

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 178 MHTHLIYKL----EFPPEDMENETQESLNIEHEGSFLIQIKKPDQHGTSQFRGLQNKRKA 233
           +  +L Y++    E+ PED ENE   S  I  E S L++I+    +  S F   ++K+ A
Sbjct: 466 LENYLDYRIDVLQEYSPEDTENENAVSQLIARELSVLLKIRDRINNNKSIFLNSEDKKYA 525

Query: 234 VFP 236
             P
Sbjct: 526 KLP 528


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.313    0.133    0.386 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 126,039,852
Number of Sequences: 539616
Number of extensions: 5642456
Number of successful extensions: 12826
Number of sequences better than 100.0: 25
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 20
Number of HSP's that attempted gapping in prelim test: 12803
Number of HSP's gapped (non-prelim): 44
length of query: 314
length of database: 191,569,459
effective HSP length: 117
effective length of query: 197
effective length of database: 128,434,387
effective search space: 25301574239
effective search space used: 25301574239
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 61 (28.1 bits)