Query         040617
Match_columns 247
No_of_seqs    162 out of 982
Neff          6.4 
Searched_HMMs 46136
Date          Fri Mar 29 10:07:26 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/040617.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/040617hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 8.7E-45 1.9E-49  292.5   7.6  127    6-134     1-129 (129)
  2 PHA00692 hypothetical protein   42.5     9.3  0.0002   26.9   0.3   10    4-13     35-44  (74)
  3 smart00265 BH4 BH4 Bcl-2 homol  28.6      66  0.0014   19.1   2.3   20   15-34      4-23  (27)
  4 cd00933 barnase Barnase, a mem  25.6 2.3E+02   0.005   22.3   5.6   23   15-40      2-24  (107)
  5 KOG3238 Chloride ion current i  24.7      99  0.0022   27.1   3.7   63    5-67    108-170 (216)
  6 smart00707 RPEL Repeat in Dros  23.3      56  0.0012   19.2   1.3   14    9-22      6-19  (26)
  7 PF07960 CBP4:  CBP4;  InterPro  22.6      45 0.00098   27.1   1.1   11   13-23     30-40  (128)
  8 PF08338 DUF1731:  Domain of un  22.2      63  0.0014   21.5   1.6   16    8-23     31-47  (48)
  9 PF05865 Cypo_polyhedrin:  Cypo  19.8   1E+02  0.0023   26.3   2.8   28   86-113   140-168 (248)
 10 PF01473 CW_binding_1:  Putativ  17.1      82  0.0018   16.4   1.1    9   61-69      7-15  (19)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=8.7e-45  Score=292.53  Aligned_cols=127  Identities=57%  Similarity=1.145  Sum_probs=97.0

Q ss_pred             CCCCceeCCChHHHHHHHHHhhHcCCCCCc-CceeecCCCCCCcccchhhcCCCCCCCceEEeccccccCCCCCcccccc
Q 040617            6 LPPGFRFHPTDEELVNYYLKRKINGQEIEL-DIIPEVDLYKCEPWELAEKSFLPSRDPEWYFFGPRDRKYPNGFRTNRAT   84 (247)
Q Consensus         6 LPpGfrF~PTDeELI~~YL~~Ki~g~~l~~-~~I~evDvy~~~PwdL~~~~~~~~~d~~wYFFt~r~~k~~~g~R~~R~t   84 (247)
                      |||||||+|||+|||.+||++|+.|.+++. .+|+++|||++|||+|++.  ...++.+||||+++++++.++.|.+|++
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~~~~i~~~Diy~~~P~~L~~~--~~~~~~~~yFF~~~~~~~~~~~r~~R~~   78 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPCEDVIHDVDIYSAHPWELPAK--FKGGDEEWYFFSPRKKKYPNGGRPNRVT   78 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS-CHSEE--GGGS-GGGCHHH--SSS-SSEEEEEEE----------S-EEE
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCcccceeecccCccChHHhhhh--ccCCCceEEEEEecccccCCcccccccc
Confidence            899999999999999999999999999887 7899999999999999953  2346679999999999999999999999


Q ss_pred             ccceeeecCCceeEee-cCceeeEEEEEEeecCCCCCCCCcCeEEEEEEeC
Q 040617           85 RAGYWKSTGKDRRVTY-QSRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRLD  134 (247)
Q Consensus        85 ~gG~Wk~~G~~~~I~~-~g~~iG~Krtl~Fy~g~~~~g~rT~WvM~EY~l~  134 (247)
                      ++|+||.+|+.++|.+ ++.+||+|++|+||.++.+++.+|+|+||||+|.
T Consensus        79 ~~G~Wk~~g~~~~i~~~~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   79 GGGYWKSTGKEKPIKDPGGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             TTEEEEEECEEEEEEE-TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             cceEEeecccccccccccceeeeeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            9999999999999998 8999999999999998888899999999999984


No 2  
>PHA00692 hypothetical protein
Probab=42.47  E-value=9.3  Score=26.91  Aligned_cols=10  Identities=70%  Similarity=1.388  Sum_probs=8.0

Q ss_pred             CCCCCCceeC
Q 040617            4 VGLPPGFRFH   13 (247)
Q Consensus         4 ~~LPpGfrF~   13 (247)
                      +..||||||-
T Consensus        35 veyppgfrfg   44 (74)
T PHA00692         35 VEYPPGFRFG   44 (74)
T ss_pred             EecCCCcccc
Confidence            4579999995


No 3  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=28.62  E-value=66  Score=19.07  Aligned_cols=20  Identities=30%  Similarity=0.421  Sum_probs=15.5

Q ss_pred             ChHHHHHHHHHhhHcCCCCC
Q 040617           15 TDEELVNYYLKRKINGQEIE   34 (247)
Q Consensus        15 TDeELI~~YL~~Ki~g~~l~   34 (247)
                      +-.|||.+|+.-|+.-...+
T Consensus         4 ~nRelV~~yv~yKLsQrgy~   23 (27)
T smart00265        4 DNRELVVDYVTYKLSQNGYE   23 (27)
T ss_pred             chHHHHHHHHHHHHhhcCCC
Confidence            45799999999999755443


No 4  
>cd00933 barnase Barnase, a member of the family of homologous microbial ribonucleases, catalyses the cleavage of single-stranded RNA via a two-step mechanism thought to be similar to that of pancreatic ribonuclease. The mechanism involves a transesterification to give a 2', 3'-cyclic phosphate intermediate, followed by hydrolysis to yield a 3' nucleotide. The active site residues His and Glu act as general acid-base groups during catalysis, while the Arg and Lys residues are important in binding the reactive phosphate, the latter probably binding the phosphate in the transition state. Barstar, a small 89 residue intracellular protein is a natural inhibitor of Barnase.
Probab=25.58  E-value=2.3e+02  Score=22.29  Aligned_cols=23  Identities=17%  Similarity=0.147  Sum_probs=14.9

Q ss_pred             ChHHHHHHHHHhhHcCCCCCcCceee
Q 040617           15 TDEELVNYYLKRKINGQEIELDIIPE   40 (247)
Q Consensus        15 TDeELI~~YL~~Ki~g~~l~~~~I~e   40 (247)
                      |++|-|..||..  .+ .||..+|.-
T Consensus         2 ~~~~~V~~y~~~--~~-~LP~~yiTK   24 (107)
T cd00933           2 NTFQGVADYLQT--YH-RLPDNYITK   24 (107)
T ss_pred             chHHHHHHHHHH--hC-cCCcceEeH
Confidence            455666678887  33 377777754


No 5  
>KOG3238 consensus Chloride ion current inducer protein [Inorganic ion transport and metabolism]
Probab=24.75  E-value=99  Score=27.07  Aligned_cols=63  Identities=21%  Similarity=0.316  Sum_probs=34.9

Q ss_pred             CCCCCceeCCChHHHHHHHHHhhHcCCCCCcCceeecCCCCCCcccchhhcCCCCCCCceEEe
Q 040617            5 GLPPGFRFHPTDEELVNYYLKRKINGQEIELDIIPEVDLYKCEPWELAEKSFLPSRDPEWYFF   67 (247)
Q Consensus         5 ~LPpGfrF~PTDeELI~~YL~~Ki~g~~l~~~~I~evDvy~~~PwdL~~~~~~~~~d~~wYFF   67 (247)
                      ...-+|||+|+|.--+...---...++.+-+.-..+.+-|.-+=|+.-......++...||=+
T Consensus       108 e~i~e~rfvpsDk~~l~a~f~qfcecqel~p~P~ED~~~~dgee~~mea~d~~~gDs~~~~t~  170 (216)
T KOG3238|consen  108 EPITEFRFVPSDKSALEAMFTQFCECQELNPDPDEDEDDYDGEEYDMEAHDAGQGDSPNSYTY  170 (216)
T ss_pred             cccccceecCCchhHHHHHHHHHHhhhhcCCCccccccccccchhhhhhhhccCCCCcccccc
Confidence            345689999999887775333444444332222455566666666665543333344444433


No 6  
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=23.26  E-value=56  Score=19.20  Aligned_cols=14  Identities=36%  Similarity=0.404  Sum_probs=11.2

Q ss_pred             CceeCCChHHHHHH
Q 040617            9 GFRFHPTDEELVNY   22 (247)
Q Consensus         9 GfrF~PTDeELI~~   22 (247)
                      ...++||.+|||..
T Consensus         6 kl~~RP~~eeLv~r   19 (26)
T smart00707        6 KLSQRPTREELEER   19 (26)
T ss_pred             HHHcCCCHHHHHHc
Confidence            45689999999973


No 7  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=22.62  E-value=45  Score=27.08  Aligned_cols=11  Identities=55%  Similarity=0.927  Sum_probs=9.4

Q ss_pred             CCChHHHHHHH
Q 040617           13 HPTDEELVNYY   23 (247)
Q Consensus        13 ~PTDeELI~~Y   23 (247)
                      .||||||+..|
T Consensus        30 tPTeEeL~~r~   40 (128)
T PF07960_consen   30 TPTEEELFKRY   40 (128)
T ss_pred             CCCHHHHHHhc
Confidence            49999999875


No 8  
>PF08338 DUF1731:  Domain of unknown function (DUF1731);  InterPro: IPR013549 This domain of unknown function appears towards the C terminus of proteins of the NAD dependent epimerase/dehydratase family (IPR001509 from INTERPRO) in bacteria, eukaryotes and archaea. Many of the proteins in which it is found are involved in cell-division inhibition. ; PDB: 3OH8_A.
Probab=22.17  E-value=63  Score=21.45  Aligned_cols=16  Identities=44%  Similarity=0.717  Sum_probs=9.3

Q ss_pred             CCceeC-CChHHHHHHH
Q 040617            8 PGFRFH-PTDEELVNYY   23 (247)
Q Consensus         8 pGfrF~-PTDeELI~~Y   23 (247)
                      -||+|+ |+=++-+.+.
T Consensus        31 ~GF~F~~p~l~~AL~~l   47 (48)
T PF08338_consen   31 AGFQFRYPTLEEALRDL   47 (48)
T ss_dssp             TT---S-SSHHHHHHH-
T ss_pred             CCCcccCCCHHHHHhcc
Confidence            499998 8888777654


No 9  
>PF05865 Cypo_polyhedrin:  Cypovirus polyhedrin protein;  InterPro: IPR008464 This family consists of several Cypovirus polyhedrin proteins. Polyhedrin is known to form a crystalline matrix (polyhedra) in infected insect cells [].; PDB: 2OH7_A 2OH5_A 2OH6_A.
Probab=19.76  E-value=1e+02  Score=26.25  Aligned_cols=28  Identities=21%  Similarity=0.481  Sum_probs=18.0

Q ss_pred             cceeeecC-CceeEeecCceeeEEEEEEe
Q 040617           86 AGYWKSTG-KDRRVTYQSRAIGMKKTLVY  113 (247)
Q Consensus        86 gG~Wk~~G-~~~~I~~~g~~iG~Krtl~F  113 (247)
                      .--|.++| +-|+|..+|++||+...|..
T Consensus       140 shpweatgikyrki~~dgeivgyshyfel  168 (248)
T PF05865_consen  140 SHPWEATGIKYRKIHRDGEIVGYSHYFEL  168 (248)
T ss_dssp             --S-B--GGG-EEEEETTEEEEEEEEEE-
T ss_pred             cCCccccCceEEEeeccceEeeeeeeeec
Confidence            34699998 56778889999999988765


No 10 
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=17.07  E-value=82  Score=16.42  Aligned_cols=9  Identities=33%  Similarity=1.335  Sum_probs=6.8

Q ss_pred             CCceEEecc
Q 040617           61 DPEWYFFGP   69 (247)
Q Consensus        61 d~~wYFFt~   69 (247)
                      ++.||||..
T Consensus         7 ~~~wYy~~~   15 (19)
T PF01473_consen    7 NGNWYYFDS   15 (19)
T ss_dssp             TTEEEEETT
T ss_pred             CCEEEEeCC
Confidence            468999953


Done!