Citrus Sinensis ID: 040619

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500----

MTGAGAGHAVERVGLPKMESTRSASCNPVRKSGPVTMDHVLLALRESKEERDIRIRSLFNFFDAANSGYLDYAQIESGLSALQIPAQYKYAKDLFKVCDANRDGRVDYQEFRRYMDIKEMELYKIFQTIDVEHNGCILPEELWDALVKAGIEISDEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVQRSKYFIAGGIAGAASRTATAPLDRLKVVLQVQTAQARLVPTIRKIWKEEGFLGFFRGNGLNVLKVAPESAIKFHAYELLKNAIGDYIGEEKDDIGAFGRLLAGGMAGAVAQTAIYPLDLVKTRLQTHACEGGKAPNLGTLTKDILVHEGPRAFYKGLVPSLLGIIPYAGIDLAAYETLKDLSRTYILTDSEPGPLVQLGCGTISGALGATCVYPLQVIRTRMQAQRSKSAAAYKGMSDVFWRTLQNEGYRGFYKGIFPNLLKVVPAASITYMVYETMKKTLDL

ccccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHccc

*************************************DHVLLALRE***ERDIRIRSLFNFFDAANSGYLDYAQIESGLSALQIPAQYKYAKDLFKVCDANRDGRVDYQEFRRYMDIKEMELYKIFQTIDVEHNGCILPEELWDALVKAGIEISDEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVQRSKYFIAGGIAGAASRTATAPLDRLKVVLQVQTAQARLVPTIRKIWKEEGFLGFFRGNGLNVLKVAPESAIKFHAYELLKNAIGDYIGEEKDDIGAFGRLLAGGMAGAVAQTAIYPLDLVKTRLQTHACEGGKAPNLGTLTKDILVHEGPRAFYKGLVPSLLGIIPYAGIDLAAYETLKDLSRTYILTDSEPGPLVQLGCGTISGALGATCVYPLQVIRTRM***********KGMSDVFWRTLQNEGYRGFYKGIFPNLLKVVPAASITYMVYETMKKTLDL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable calcium-binding mitochondrial carrier F17E5.2	Calcium-dependent mitochondrial solute carrier.	probable	Q19529
Calcium-binding mitochondrial carrier protein SCaMC-1	Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.	probable	Q8BMD8
Calcium-binding mitochondrial carrier SAL1	Calcium-dependent mitochondrial solute carrier.	probable	P0CI40

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 224-503
View the alignment between query and template
View the model in PyMOL

Template: 3SG6, chain A
Confidence level:very confident
Coverage over the Query: 24-183
View the alignment between query and template
View the model in PyMOL

Template: 2F33, chain A
Confidence level:very confident
Coverage over the Query: 7-186
View the alignment between query and template
View the model in PyMOL