BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 040697
         (61 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q0PW25|RDRP_CFMVN Replicase polyprotein P2AB OS=Cocksfoot mottle virus (isolate
           Dactylis glomerata/Norway/CfMV-NO/1995) GN=ORF2A-2B PE=1
           SV=1
          Length = 942

 Score = 30.8 bits (68), Expect = 2.7,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 12/61 (19%)

Query: 2   LRIDIGSLS--YEKASYSRGFSKSFGEIFYTSNYGTLQLTNGLASTPQMGGILDYSGVWC 59
           +RI++GS      KA+ SR         FY     T QLTNG   T ++ G++  SG +C
Sbjct: 716 MRIELGSFPALMAKAAISR---------FYCLMNATFQLTNGELLTQELPGLMK-SGSYC 765

Query: 60  T 60
           T
Sbjct: 766 T 766


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.319    0.136    0.413 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 22,892,898
Number of Sequences: 539616
Number of extensions: 676325
Number of successful extensions: 1324
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1324
Number of HSP's gapped (non-prelim): 1
length of query: 61
length of database: 191,569,459
effective HSP length: 34
effective length of query: 27
effective length of database: 173,222,515
effective search space: 4677007905
effective search space used: 4677007905
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)