BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 040727
(231 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3AU8|A Chain A, Crystal Structure Of The Ternary Complex Of An Isomerase
pdb|3AU8|B Chain B, Crystal Structure Of The Ternary Complex Of An Isomerase
pdb|3AU9|A Chain A, Crystal Structure Of The Quaternary Complex-1 Of An
Isomerase
pdb|3AU9|B Chain B, Crystal Structure Of The Quaternary Complex-1 Of An
Isomerase
pdb|3AUA|A Chain A, Crystal Structure Of The Quaternary Complex-2 Of An
Isomerase
pdb|3AUA|B Chain B, Crystal Structure Of The Quaternary Complex-2 Of An
Isomerase
Length = 488
Score = 29.6 bits (65), Expect = 1.6, Method: Compositional matrix adjust.
Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
Query: 110 ESNKIEQIESEKSLDENKWMRLHYEHRERYCPEEACTCIAPLPEGYKRLIKWPKAGIGFV 169
E NKIE + + K+L NK + YE + PE C + E K L+K K
Sbjct: 99 ECNKIENVFNVKALYVNKSVNELYEQAREFLPEYLCIHDKSVYEELKELVKNIKDYKP-- 156
Query: 170 LMLCG 174
++LCG
Sbjct: 157 IILCG 161
>pdb|4GAE|A Chain A, Crystal Structure Of Plasmodium Dxr In Complex With A
Pyridine- Containing Inhibitor
pdb|4GAE|B Chain B, Crystal Structure Of Plasmodium Dxr In Complex With A
Pyridine- Containing Inhibitor
Length = 426
Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust.
Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
Query: 110 ESNKIEQIESEKSLDENKWMRLHYEHRERYCPEEACTCIAPLPEGYKRLIKWPKAGIGFV 169
E NKIE + + K+L NK + YE + PE C + E K L+K K
Sbjct: 37 ECNKIENVFNVKALYVNKSVNELYEQAREFLPEYLCIHDKSVYEELKELVKNIKDYKP-- 94
Query: 170 LMLCG 174
++LCG
Sbjct: 95 IILCG 99
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.137 0.411
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,759,223
Number of Sequences: 62578
Number of extensions: 278702
Number of successful extensions: 463
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 461
Number of HSP's gapped (non-prelim): 3
length of query: 231
length of database: 14,973,337
effective HSP length: 96
effective length of query: 135
effective length of database: 8,965,849
effective search space: 1210389615
effective search space used: 1210389615
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)