BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 040727
         (231 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3AU8|A Chain A, Crystal Structure Of The Ternary Complex Of An Isomerase
 pdb|3AU8|B Chain B, Crystal Structure Of The Ternary Complex Of An Isomerase
 pdb|3AU9|A Chain A, Crystal Structure Of The Quaternary Complex-1 Of An
           Isomerase
 pdb|3AU9|B Chain B, Crystal Structure Of The Quaternary Complex-1 Of An
           Isomerase
 pdb|3AUA|A Chain A, Crystal Structure Of The Quaternary Complex-2 Of An
           Isomerase
 pdb|3AUA|B Chain B, Crystal Structure Of The Quaternary Complex-2 Of An
           Isomerase
          Length = 488

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 110 ESNKIEQIESEKSLDENKWMRLHYEHRERYCPEEACTCIAPLPEGYKRLIKWPKAGIGFV 169
           E NKIE + + K+L  NK +   YE    + PE  C     + E  K L+K  K      
Sbjct: 99  ECNKIENVFNVKALYVNKSVNELYEQAREFLPEYLCIHDKSVYEELKELVKNIKDYKP-- 156

Query: 170 LMLCG 174
           ++LCG
Sbjct: 157 IILCG 161


>pdb|4GAE|A Chain A, Crystal Structure Of Plasmodium Dxr In Complex With A
           Pyridine- Containing Inhibitor
 pdb|4GAE|B Chain B, Crystal Structure Of Plasmodium Dxr In Complex With A
           Pyridine- Containing Inhibitor
          Length = 426

 Score = 29.3 bits (64), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 110 ESNKIEQIESEKSLDENKWMRLHYEHRERYCPEEACTCIAPLPEGYKRLIKWPKAGIGFV 169
           E NKIE + + K+L  NK +   YE    + PE  C     + E  K L+K  K      
Sbjct: 37  ECNKIENVFNVKALYVNKSVNELYEQAREFLPEYLCIHDKSVYEELKELVKNIKDYKP-- 94

Query: 170 LMLCG 174
           ++LCG
Sbjct: 95  IILCG 99


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.137    0.411 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,759,223
Number of Sequences: 62578
Number of extensions: 278702
Number of successful extensions: 463
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 461
Number of HSP's gapped (non-prelim): 3
length of query: 231
length of database: 14,973,337
effective HSP length: 96
effective length of query: 135
effective length of database: 8,965,849
effective search space: 1210389615
effective search space used: 1210389615
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)