Query         040778
Match_columns 262
No_of_seqs    96 out of 98
Neff          2.6 
Searched_HMMs 46136
Date          Fri Mar 29 11:43:44 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/040778.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/040778hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00642 zf-CCCH:  Zinc finger   97.2 4.6E-05 9.9E-10   47.7  -0.9   25  227-251     2-26  (27)
  2 smart00356 ZnF_C3H1 zinc finge  97.0 0.00061 1.3E-08   40.7   2.2   22  229-251     5-26  (27)
  3 KOG2135 Proteins containing th  96.7 0.00043 9.2E-09   68.9   0.3   33  226-258   210-242 (526)
  4 COG5152 Uncharacterized conser  92.5   0.044 9.5E-07   50.6   0.5   28  226-253   139-166 (259)
  5 KOG1677 CCCH-type Zn-finger pr  90.9    0.16 3.4E-06   45.8   2.3   31  225-255   174-204 (332)
  6 KOG1813 Predicted E3 ubiquitin  87.6    0.16 3.5E-06   48.5  -0.2   24  227-250   185-208 (313)
  7 KOG1595 CCCH-type Zn-finger pr  85.8    0.37   8E-06   48.8   1.3   23  229-252   237-259 (528)
  8 PF14608 zf-CCCH_2:  Zinc finge  84.5    0.68 1.5E-05   27.3   1.5   18  231-251     2-19  (19)
  9 KOG1677 CCCH-type Zn-finger pr  83.0    0.56 1.2E-05   42.3   1.1   31  226-256   130-161 (332)
 10 COG5063 CTH1 CCCH-type Zn-fing  82.9    0.64 1.4E-05   45.0   1.5   33  226-258   272-304 (351)
 11 KOG1040 Polyadenylation factor  74.1     1.9 4.1E-05   41.2   1.8   27  226-252   103-129 (325)
 12 COG5063 CTH1 CCCH-type Zn-fing  55.6      18 0.00039   35.4   4.4   27  226-252   113-139 (351)
 13 KOG1492 C3H1-type Zn-finger pr  45.8     7.4 0.00016   37.1   0.2   24  230-253   208-231 (377)
 14 KOG2494 C3H1-type Zn-finger pr  38.0      11 0.00024   36.6   0.2   29  229-258    38-67  (331)
 15 COG5084 YTH1 Cleavage and poly  36.8      19 0.00041   34.2   1.4   24  229-252   135-158 (285)
 16 KOG2333 Uncharacterized conser  34.0      20 0.00042   37.3   1.1   22  227-248   113-134 (614)
 17 KOG4791 Uncharacterized conser  26.1      59  0.0013   34.0   2.9   51  193-254    93-143 (667)
 18 PF11942 Spt5_N:  Spt5 transcri  26.0      31 0.00068   27.1   0.8   33   35-68     40-74  (97)
 19 PF11705 RNA_pol_3_Rpc31:  DNA-  22.5 1.7E+02  0.0037   25.9   4.8   14  168-181    31-44  (233)
 20 KOG0153 Predicted RNA-binding   20.8      43 0.00094   33.2   0.8   24  229-253   162-185 (377)

No 1  
>PF00642 zf-CCCH:  Zinc finger C-x8-C-x5-C-x3-H type (and similar);  InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents C-x8-C-x5-C-x3-H (CCCH) type Zinc finger (Znf) domains. Proteins containing CCCH Znf domains include Znf proteins from eukaryotes involved in cell cycle or growth phase-related regulation, e.g. human TIS11B (butyrate response factor 1), a probable regulatory protein involved in regulating the response to growth factors, and the mouse TTP growth factor-inducible nuclear protein, which has the same function. The mouse TTP protein is induced by growth factors. Another protein containing this domain is the human splicing factor U2AF 35kDa subunit, which plays a critical role in both constitutive and enhancer-dependent splicing by mediating essential protein-protein interactions and protein-RNA interactions required for 3' splice site selection. It has been shown that different CCCH-type Znf proteins interact with the 3'-untranslated region of various mRNA [, ]. This type of Znf is very often present in two copies. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 1M9O_A 1RGO_A 2CQE_A 2FC6_A 2D9M_A 2E5S_A 2RHK_C 2D9N_A 3D2S_A 3D2Q_C ....
Probab=97.24  E-value=4.6e-05  Score=47.72  Aligned_cols=25  Identities=40%  Similarity=0.816  Sum_probs=20.2

Q ss_pred             CCCCCCCccccccccCCCCCCCCCC
Q 040778          227 SRQRCRDFEERGFCLRGDMCPMEHG  251 (262)
Q Consensus       227 ~r~RCrDydekGyC~rGd~CpydHG  251 (262)
                      ++..|++|.+.|+|.+|+.|.|.|+
T Consensus         2 k~~~C~~f~~~g~C~~G~~C~f~H~   26 (27)
T PF00642_consen    2 KTKLCRFFMRTGTCPFGDKCRFAHG   26 (27)
T ss_dssp             TSSB-HHHHHTS--TTGGGSSSBSS
T ss_pred             ccccChhhccCCccCCCCCcCccCC
Confidence            4568999999999999999999997


No 2  
>smart00356 ZnF_C3H1 zinc finger.
Probab=96.95  E-value=0.00061  Score=40.74  Aligned_cols=22  Identities=41%  Similarity=1.025  Sum_probs=20.5

Q ss_pred             CCCCCccccccccCCCCCCCCCC
Q 040778          229 QRCRDFEERGFCLRGDMCPMEHG  251 (262)
Q Consensus       229 ~RCrDydekGyC~rGd~CpydHG  251 (262)
                      ..|++| ++|.|.+|+.|+|.|.
T Consensus         5 ~~C~~~-~~g~C~~g~~C~~~H~   26 (27)
T smart00356        5 ELCKFF-KRGYCPYGDRCKFAHP   26 (27)
T ss_pred             CcCcCc-cCCCCCCCCCcCCCCc
Confidence            479999 9999999999999996


No 3  
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only]
Probab=96.71  E-value=0.00043  Score=68.89  Aligned_cols=33  Identities=39%  Similarity=0.672  Sum_probs=30.7

Q ss_pred             CCCCCCCCccccccccCCCCCCCCCCCCccccc
Q 040778          226 ISRQRCRDFEERGFCLRGDMCPMEHGVNRIVVE  258 (262)
Q Consensus       226 ~~r~RCrDydekGyC~rGd~CpydHG~Dpvvv~  258 (262)
                      ....||.+|++.|||.+|++|||+||.++||++
T Consensus       210 ~s~~r~k~fee~g~~~r~el~p~~hg~~~vv~~  242 (526)
T KOG2135|consen  210 NSENRRKFFEEFGVLERGELCPTHHGCVPVVSK  242 (526)
T ss_pred             ccHHhhhhhHhhceeeeccccccccccceeEee
Confidence            456789999999999999999999999999987


No 4  
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=92.45  E-value=0.044  Score=50.55  Aligned_cols=28  Identities=32%  Similarity=0.807  Sum_probs=23.9

Q ss_pred             CCCCCCCCccccccccCCCCCCCCCCCC
Q 040778          226 ISRQRCRDFEERGFCLRGDMCPMEHGVN  253 (262)
Q Consensus       226 ~~r~RCrDydekGyC~rGd~CpydHG~D  253 (262)
                      ...-.|.||.+-|||-.||+|.|-|.-+
T Consensus       139 ~qpdVCKdyk~TGYCGYGDsCKflH~R~  166 (259)
T COG5152         139 TQPDVCKDYKETGYCGYGDSCKFLHDRS  166 (259)
T ss_pred             cCcccccchhhcccccCCchhhhhhhhh
Confidence            3445799999999999999999999544


No 5  
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only]
Probab=90.90  E-value=0.16  Score=45.80  Aligned_cols=31  Identities=26%  Similarity=0.599  Sum_probs=27.3

Q ss_pred             CCCCCCCCCccccccccCCCCCCCCCCCCcc
Q 040778          225 GISRQRCRDFEERGFCLRGDMCPMEHGVNRI  255 (262)
Q Consensus       225 ~~~r~RCrDydekGyC~rGd~CpydHG~Dpv  255 (262)
                      ..+..-|..|.+-|+|..|..|.|-|+.+-.
T Consensus       174 ~~kt~lC~~f~~tG~C~yG~rC~F~H~~~~~  204 (332)
T KOG1677|consen  174 KYKTKLCPKFQKTGLCKYGSRCRFIHGEPED  204 (332)
T ss_pred             CCCCcCCCccccCCCCCCCCcCeecCCCccc
Confidence            3677889999999999999999999998733


No 6  
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=87.57  E-value=0.16  Score=48.53  Aligned_cols=24  Identities=38%  Similarity=0.958  Sum_probs=21.6

Q ss_pred             CCCCCCCccccccccCCCCCCCCC
Q 040778          227 SRQRCRDFEERGFCLRGDMCPMEH  250 (262)
Q Consensus       227 ~r~RCrDydekGyC~rGd~CpydH  250 (262)
                      ..-.|.||+|-|||-.|+.|.|-|
T Consensus       185 qpDicKdykeTgycg~gdSckFlh  208 (313)
T KOG1813|consen  185 QPDICKDYKETGYCGYGDSCKFLH  208 (313)
T ss_pred             CchhhhhhHhhCcccccchhhhhh
Confidence            345799999999999999999987


No 7  
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only]
Probab=85.82  E-value=0.37  Score=48.83  Aligned_cols=23  Identities=48%  Similarity=1.084  Sum_probs=20.2

Q ss_pred             CCCCCccccccccCCCCCCCCCCC
Q 040778          229 QRCRDFEERGFCLRGDMCPMEHGV  252 (262)
Q Consensus       229 ~RCrDydekGyC~rGd~CpydHG~  252 (262)
                      .-|.+|.. |-|-+||+|.|-||.
T Consensus       237 tpCPefrk-G~C~rGD~CEyaHgv  259 (528)
T KOG1595|consen  237 TPCPEFRK-GSCERGDSCEYAHGV  259 (528)
T ss_pred             ccCccccc-CCCCCCCccccccce
Confidence            34999876 999999999999984


No 8  
>PF14608 zf-CCCH_2:  Zinc finger C-x8-C-x5-C-x3-H type
Probab=84.49  E-value=0.68  Score=27.30  Aligned_cols=18  Identities=39%  Similarity=0.922  Sum_probs=14.7

Q ss_pred             CCCccccccccCCCCCCCCCC
Q 040778          231 CRDFEERGFCLRGDMCPMEHG  251 (262)
Q Consensus       231 CrDydekGyC~rGd~CpydHG  251 (262)
                      |+.+-.   |..++.|+|.|.
T Consensus         2 Ck~~~~---C~~~~~C~f~HP   19 (19)
T PF14608_consen    2 CKFGPN---CTNGDNCPFSHP   19 (19)
T ss_pred             CcCcCC---CCCCCcCccCCc
Confidence            776544   999999999994


No 9  
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only]
Probab=83.03  E-value=0.56  Score=42.28  Aligned_cols=31  Identities=29%  Similarity=0.762  Sum_probs=27.4

Q ss_pred             CCCCCCCCccccccccC-CCCCCCCCCCCccc
Q 040778          226 ISRQRCRDFEERGFCLR-GDMCPMEHGVNRIV  256 (262)
Q Consensus       226 ~~r~RCrDydekGyC~r-Gd~CpydHG~Dpvv  256 (262)
                      .+...|+.|.+.|+|.. |+.|.|.||.+-+-
T Consensus       130 ~kt~lc~~~~~~g~c~y~ge~crfah~~~e~r  161 (332)
T KOG1677|consen  130 YKTPLCRSFRKSGTCKYRGEQCRFAHGLEELR  161 (332)
T ss_pred             ccCCcceeeecCccccccCchhhhcCCccccc
Confidence            56778999999999999 99999999887554


No 10 
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only]
Probab=82.95  E-value=0.64  Score=45.03  Aligned_cols=33  Identities=24%  Similarity=0.598  Sum_probs=28.5

Q ss_pred             CCCCCCCCccccccccCCCCCCCCCCCCccccc
Q 040778          226 ISRQRCRDFEERGFCLRGDMCPMEHGVNRIVVE  258 (262)
Q Consensus       226 ~~r~RCrDydekGyC~rGd~CpydHG~Dpvvv~  258 (262)
                      -+.+-|.+|+.-|||..|--|+|-||.|-.|-.
T Consensus       272 frTePcinwe~sGyc~yg~Rc~F~hgd~~~ie~  304 (351)
T COG5063         272 FRTEPCINWEKSGYCPYGLRCCFKHGDDSDIEM  304 (351)
T ss_pred             cccCCccchhhcccCccccccccccCChhhccc
Confidence            456789999999999999999999999976543


No 11 
>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification]
Probab=74.14  E-value=1.9  Score=41.20  Aligned_cols=27  Identities=33%  Similarity=0.663  Sum_probs=24.2

Q ss_pred             CCCCCCCCccccccccCCCCCCCCCCC
Q 040778          226 ISRQRCRDFEERGFCLRGDMCPMEHGV  252 (262)
Q Consensus       226 ~~r~RCrDydekGyC~rGd~CpydHG~  252 (262)
                      .+...|..|...|+|..+..|+|-|+.
T Consensus       103 ~k~rec~ff~~~g~c~~~~~c~y~h~d  129 (325)
T KOG1040|consen  103 TKMRECKFFSLFGECTNGKDCPYLHGD  129 (325)
T ss_pred             cccccccccccccccccccCCcccCCC
Confidence            455689999999999999999999986


No 12 
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only]
Probab=55.64  E-value=18  Score=35.42  Aligned_cols=27  Identities=22%  Similarity=0.322  Sum_probs=22.7

Q ss_pred             CCCCCCCCccccccccCCCCCCCCCCC
Q 040778          226 ISRQRCRDFEERGFCLRGDMCPMEHGV  252 (262)
Q Consensus       226 ~~r~RCrDydekGyC~rGd~CpydHG~  252 (262)
                      .+...|++--+.+||..++.|||.|..
T Consensus       113 ~kt~~l~ss~~~~~~~~p~~n~fahs~  139 (351)
T COG5063         113 YKTEMLRSSTEIPYCRYPDKNPFAHSK  139 (351)
T ss_pred             ccchhhhccccccccccCCCCcCCCcc
Confidence            456678888899999999999999965


No 13 
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only]
Probab=45.79  E-value=7.4  Score=37.14  Aligned_cols=24  Identities=29%  Similarity=0.765  Sum_probs=22.0

Q ss_pred             CCCCccccccccCCCCCCCCCCCC
Q 040778          230 RCRDFEERGFCLRGDMCPMEHGVN  253 (262)
Q Consensus       230 RCrDydekGyC~rGd~CpydHG~D  253 (262)
                      -||-|...|+|-.|+.|.|-|.+-
T Consensus       208 ycryynangicgkgaacrfvhept  231 (377)
T KOG1492|consen  208 YCRYYNANGICGKGAACRFVHEPT  231 (377)
T ss_pred             EEEEecCCCcccCCceeeeecccc
Confidence            699999999999999999999654


No 14 
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription]
Probab=38.03  E-value=11  Score=36.59  Aligned_cols=29  Identities=38%  Similarity=0.765  Sum_probs=22.9

Q ss_pred             CCCCCccccccccCCCC-CCCCCCCCccccc
Q 040778          229 QRCRDFEERGFCLRGDM-CPMEHGVNRIVVE  258 (262)
Q Consensus       229 ~RCrDydekGyC~rGd~-CpydHG~Dpvvv~  258 (262)
                      +.|||| -||.|.|||. |.|-|=.--+=|+
T Consensus        38 eVCReF-~rn~C~R~d~~CkfaHP~~~~~V~   67 (331)
T KOG2494|consen   38 EVCREF-LRNTCSRGDRECKFAHPPKNCQVS   67 (331)
T ss_pred             HHHHHH-HhccccCCCccccccCCCCCCCcc
Confidence            569997 5899999999 9999965544343


No 15 
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only]
Probab=36.79  E-value=19  Score=34.22  Aligned_cols=24  Identities=33%  Similarity=0.677  Sum_probs=21.9

Q ss_pred             CCCCCccccccccCCCCCCCCCCC
Q 040778          229 QRCRDFEERGFCLRGDMCPMEHGV  252 (262)
Q Consensus       229 ~RCrDydekGyC~rGd~CpydHG~  252 (262)
                      --|+.|-.+|.|..|..|+|-|..
T Consensus       135 ~~c~~Fs~~G~cs~g~~c~~~h~d  158 (285)
T COG5084         135 PPCRSFSLKGSCSSGPSCGYSHID  158 (285)
T ss_pred             CCcccccccceeccCCCCCccccC
Confidence            469999999999999999999974


No 16 
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only]
Probab=33.96  E-value=20  Score=37.29  Aligned_cols=22  Identities=36%  Similarity=0.712  Sum_probs=20.2

Q ss_pred             CCCCCCCccccccccCCCCCCC
Q 040778          227 SRQRCRDFEERGFCLRGDMCPM  248 (262)
Q Consensus       227 ~r~RCrDydekGyC~rGd~Cpy  248 (262)
                      ....|.-|+..|||..|-.|.|
T Consensus       113 ig~~Cp~f~s~G~Cp~G~~CRF  134 (614)
T KOG2333|consen  113 IGPSCPVFESLGFCPYGFKCRF  134 (614)
T ss_pred             cCCccceeeccccCCccceeeh
Confidence            3468999999999999999999


No 17 
>KOG4791 consensus Uncharacterized conserved protein [Function unknown]
Probab=26.10  E-value=59  Score=33.95  Aligned_cols=51  Identities=10%  Similarity=-0.013  Sum_probs=30.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCcCCCCCCCCCCCCCccccccccCCCCCCCCCCCCc
Q 040778          193 LIPGVPNGGLDTLPSIGLQGTLRPPLNSSLNMGISRQRCRDFEERGFCLRGDMCPMEHGVNR  254 (262)
Q Consensus       193 ~mPGMppm~l~~~h~~g~qG~lqp~~~~~~~~~~~r~RCrDydekGyC~rGd~CpydHG~Dp  254 (262)
                      .||+-|.|.+-++|-..    -+++|+..      .--| ++.-||||+.+|+|-+-|-+-+
T Consensus        93 ~~p~~pe~ev~~~~~SA----q~~sV~~~------p~P~-l~~~K~~e~~~D~~s~Lh~P~A  143 (667)
T KOG4791|consen   93 TVPESPEEEVKASQLSA----QQNSVQSN------PSPQ-LRSVKKVESSEDVPSPLHPPVA  143 (667)
T ss_pred             CCCCCcccccccccccC----CCcccccC------CchH-HHHhhhhhhhccccccCCCCcc
Confidence            45555666666555432    12233221      1123 5678999999999999886533


No 18 
>PF11942 Spt5_N:  Spt5 transcription elongation factor, acidic N-terminal;  InterPro: IPR022581  This is the very acidic N-terminal domain of the early transcription elongation factor Spt5 []. The Spt5-Spt4 complex regulates early transcription elongation by RNA polymerase II and has an imputed role in pre-mRNA processing via its physical association with mRNA capping enzymes. The actual function of this N-terminal domain is not known although it is dispensable for binding to Spt4 [], nor is it essential for RNA polymerase II binding []. 
Probab=26.01  E-value=31  Score=27.10  Aligned_cols=33  Identities=18%  Similarity=0.393  Sum_probs=15.8

Q ss_pred             ccchhhhhhhccccccccchhhhhchhhh--hcCCC
Q 040778           35 RNHKHRRRETRSQSLERDSLDQVYMRSYR--KRNKP   68 (262)
Q Consensus        35 RNHKHRRRe~rsqs~~rd~~e~~~~r~~k--kr~~~   68 (262)
                      +.+.||+...+-+-...-..+.+ ...||  ||+..
T Consensus        40 ~d~~~r~~d~~r~~~~~~dae~l-ae~~k~~~RY~~   74 (97)
T PF11942_consen   40 DDRRHRRLDRRREMEEEEDAEEL-AEYLKLSERYAR   74 (97)
T ss_pred             hHhhhhhhhhhHHHHhccCHHHH-HHHHHHHHHhcc
Confidence            45566665444333333222333 44667  66543


No 19 
>PF11705 RNA_pol_3_Rpc31:  DNA-directed RNA polymerase III subunit Rpc31;  InterPro: IPR024661 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. RNA polymerase III contains seventeen subunits in yeasts and in human cells. Twelve of these are akin to RNA polymerase I or II and the other five are RNA polymerase III-specific, and form the functionally distinct groups: (i) Rpc31-Rpc34-Rpc82, and (ii) Rpc37-Rpc53. Rpc31, Rpc34 and Rpc82 form a cluster of enzyme-specific subunits that contribute to transcription initiation in Saccharomyces cerevisiae and Homo sapiens. There is evidence that these subunits are anchored at or near the N-terminal Zn-fold of Rpc1, itself prolonged by a highly conserved but RNA polymerase III-specific domain []. This entry represents the Rpc31 subunit.
Probab=22.52  E-value=1.7e+02  Score=25.92  Aligned_cols=14  Identities=36%  Similarity=0.550  Sum_probs=7.3

Q ss_pred             CCCCCCCCCCCCCC
Q 040778          168 MPPSRFAGRGLPNI  181 (262)
Q Consensus       168 ~ppg~fpg~gp~~~  181 (262)
                      -|+.|||.-.+|-+
T Consensus        31 ~P~~lfP~~~~P~~   44 (233)
T PF11705_consen   31 QPPPLFPPLNLPVP   44 (233)
T ss_pred             CCCCCCCCCCCCCC
Confidence            44667764444433


No 20 
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]
Probab=20.81  E-value=43  Score=33.23  Aligned_cols=24  Identities=38%  Similarity=0.783  Sum_probs=19.1

Q ss_pred             CCCCCccccccccCCCCCCCCCCCC
Q 040778          229 QRCRDFEERGFCLRGDMCPMEHGVN  253 (262)
Q Consensus       229 ~RCrDydekGyC~rGd~CpydHG~D  253 (262)
                      ..|..| .+|=|-||+.|+|-|.-.
T Consensus       162 ~Icsf~-v~geckRG~ec~yrhEkp  185 (377)
T KOG0153|consen  162 HICSFF-VKGECKRGAECPYRHEKP  185 (377)
T ss_pred             ccccce-eeccccccccccccccCC
Confidence            457765 577999999999999653


Done!