Citrus Sinensis ID: 040782

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-----

MADKKLKQKRRRPDPTSDDESELPFKNILKPDQAILETLKQLFLAATTTTTAAANGASTSSSSSKPLTLSDLSLSATCREVTDLSLSAVQSTIETLILQIARSILAGNGFSFQVPSRASSNQLYVPELDRIVLKDKTTLRPFASLSTVRKSTITVKILSLIHQLCLRNIHVTKRDLFYTDVKLFQDQTQSDAVLDDVACILGCTRSSLNVIAAEKGVVVGRLIFSDNGDMIDCTKMGMGGKAIPPNIDRVGDMQSDAMFILLVEKDAAYIRLAEDRFYNRFPCIIVTAKGQPDVATRLFLRKMKMELKLPVLALVDSDPYGLKILSVYGCGSKNMSYDSANLTTPDIKWLGIRPSDLDKYKIPEQCRLPMTEQDIKTGKDLLEEDFVKKNPGWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQKDWL

ccccHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccccEEEEccccCEEEcccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccccccccHHHHHHHHHHHHHHHcccccccccEEccccEEEEEEEEEEcccEEEccccccccEEcccccccccccccccEEEEEEEEHHHHHHHHHccccccccEEEEECcccccHHHHHHHHHHHHcccccEEEEEcccccccEEEEEEccccccccccccccccccCEEEEccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHcccEEEEHHHHHccccccHHcHHHHHHHccccc

***************************ILKPDQAILETLKQLFLAATT*************************LSATCREVTDLSLSAVQSTIETLILQIARSILAGNGFSFQVPSRASSNQLYVPELDRIVLKDKTTLRPFASLSTVRKSTITVKILSLIHQLCLRNIHVTKRDLFYTDVKLFQDQTQSDAVLDDVACILGCTRSSLNVIAAEKGVVVGRLIFSDNGDMIDCTKMGMGGKAIPPNIDRVGDMQSDAMFILLVEKDAAYIRLAEDRFYNRFPCIIVTAKGQPDVATRLFLRKMKMELKLPVLALVDSDPYGLKILSVYGCGSKNMSYDSANLTTPDIKWLGIRPSDLDKYKIPEQCRLPMTEQDIKTGKDLLEEDFVKKNPGWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQKDWL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DNA topoisomerase 6 subunit A	Component of the DNA topoisomerase VI involved in chromatin organization and progression of endoreduplication cycles. Relaxes both positive and negative superturns and exhibits a strong decatenase activity. Involved in cell-elongation processes.	confident	Q9LZ03
Meiotic recombination protein SPO11	Required for meiotic recombination. Mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination.	probable	Q9WTK8
Meiotic recombination protein SPO11	Required for meiotic recombination. Mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination.	probable	Q9Y5K1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZBK, chain A
Confidence level:very confident
Coverage over the Query: 86-116,138-435
View the alignment between query and template
View the model in PyMOL