Citrus Sinensis ID: 040791


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-----
MALIVDQQSNFKHYCKICKKGFGCGRALGGHMRAHGIGDESGHIDDDDQASDWEDKLGGNVPPTNKRMYALRANPNRLKSCRVCENCGKEFLSWKSFLEHGKCSSEDAESLVSSPGSDGEDGTPRRGCGWSKRKRSLRAKVGNCPSSEEEDLANCLMMLSNATVDPLDAEPEESCASASKEEERRNSMNFIGPISMDKAKGVANKGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHMDDSLADEDHDVITHEEFFPTKSTSAMQFDHGANNNNAPLASSSKRKSKVHECSICHRVFSSGQALGGHKRCHWITSNSPDASSLPKFQQFHHDHGDQIQQRPKFIDDSDPLDLKLDLNLPAPEDDHARGGRREHVSMEVSTDIYLQPWIGVDAKEKDIDHHQHNQEINCTTSIQNNNVDDEADSKVKLAKLSEIKDMNISGGSSPWLQVGIGSTTDVDADT
ccEEEcccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccHHHHHcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccEEEEccccccccccc
cEEEEEccccccEEEEEEcccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccHccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccHccccccccccccccccccccccccEEEEcccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccHHHHccccccccccccccEEccccccccccccccccccccccccccccccccccccHccHHHHHHHHHHHHHcccccccccEEEEEccccccccccc
MALIVDQQSNFKHYCKICKkgfgcgralgghmrahgigdesghiddddqasdwedklggnvpptnkRMYALranpnrlkscrvcenCGKEFLSWKsflehgkcssedaeslvsspgsdgedgtprrgcgwskrkRSLRakvgncpsseeEDLANCLMMLSnatvdpldaepeescasaSKEEErrnsmnfigpismdkakgvankglfeckACKKvfnshqalgghrashkKVKGCFAARldhmddsladedhdvitheeffptkstsamqfdhgannnnaplassskrkskvhecsichrvfssgqalgghkrchwitsnspdasslpkfqqfhhdhgdqiqqrpkfiddsdpldlkldlnlpapeddharggrrehvsmevstdiylqpwigvdakekdidhhqhnqeincttsiqnnnvddeaDSKVKLAKLSEikdmnisggsspwlqvgigsttdvdadt
MALIVDQQSNFKHYCKICKKGFGCGRALGGHMRAHGIGDESGHIDDDDQASDWEDklggnvpptnkrmyalranpnrlkscRVCENCGKEFLSWKSFLEHGKCSSEDAEslvsspgsdgedgtprrgcgwskrkrslrakvgncpsseEEDLANCLMMLSNATVDPLDAEPEESCAsaskeeerrnsmnfigpismDKAKGVANKGLFECKACKKVFNSHqalgghrashKKVKGCFAARLDHMDDSLADEDHDVITHEEFFPTKSTSAMQFDHGANNNNAPLASSSKRKSKVHECSICHRVFSSGQALGGHKRCHWITSNSPDASSLPKFQQFHHDHGDQIQQRPKFIDDSDPLDLKLDLNlpapeddharggrrehvsmevsTDIYLQPWIGVDAKEKDIDHHQHNQeincttsiqnnnvddEADSKVKLAKLSEIkdmnisggsspwlqvgigsttdvdadt
MALIVDQQSNFKHYCKICKKGFGCGRALGGHMRAHGIGDESGHIDDDDQASDWEDKLGGNVPPTNKRMYALRANPNRLKSCRVCENCGKEFLSWKSFLEHGKCSSEDAESLVSSPGSDGEDGTPRRGCGWSKRKRSLRAKVGNCPSSEEEDLANCLMMLSNATVDPLDaepeescasaskeeeRRNSMNFIGPISMDKAKGVANKGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHMDDSLADEDHDVITHEEFFPTKSTSAMQFDHGannnnaplasssKRKSKVHECSICHRVFSSGQALGGHKRCHWITSNSPDASSLPKFQQFHHDHGDQIQQRPKFIddsdpldlkldlnlPAPEDDHARGGRREHVSMEVSTDIYLQPWIGVDAKEKDIDHHQHNQEINCTTSIQNNNVDDEADSKVKLAKLSEIKDMNISGGSSPWLQVGIGSTTDVDADT
****VDQQSNFKHYCKICKKGFGCGRALGGHMRAHGI*******************************YALRANPNRLKSCRVCENCGKEFLSWKSFLEH*************************************************************************************************KAKGVANKGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDH************I*************************************HECSICHRVFSSGQALGGHKRCHWIT***************************************************************VSTDIYLQPWIGVDAKEK*****************************************************************
*A****QQSNFKHYCKICKKGFGCGRALGGHMRAHG******************************************************************************************************************************************************************************KA*K*******************************************************************************HECSICHRVFSSGQALGGHKRCHW**************************************DLKLDLNLPAPE******************************************************************KLSEIKDMNISGGSSPWLQVGIG*********
MALIVDQQSNFKHYCKICKKGFGCGRALGGHMRAHGIGDESGHIDDDDQASDWEDKLGGNVPPTNKRMYALRANPNRLKSCRVCENCGKEFLSWKSFLEHG************************************************EDLANCLMMLSNATVDPL*****************RNSMNFIGPISMDKAKGVANKGLFECKACKKVFNSH***********KVKGCFAARLDHMDDSLADEDHDVITHEEFFPTKSTSAMQFDHGANNNNA**************CSICHRVFSSGQALGGHKRCHWITSNSPDASSLPKFQQFHHDHGDQIQQRPKFIDDSDPLDLKLDLNLPAPEDDHARGGRREHVSMEVSTDIYLQPWIGVDAKEKDIDHHQHNQEINCTTSIQNNNVDDEADSKVKLAKLSEIKDMNISGGSSPWLQVGIGSTTDVDADT
MALIVDQQSNFKHYCKICKKGFGCGRAL*************************************************LKSCRVCENCGKEFLSWKSFLE***********************************************SEEEDLANCLMMLSN******************************************NKGLFECKACKKVFNSHQALGGH*****************************************************************KVHECSICHRVFSSGQAL*********************************************LDLKLDLNLPAPEDDHARG**REHV*M****DIY***WIGV*******************************************KDMNISGGSSPWL*V*IGS********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALIVDQQSNFKHYCKICKKGFGCGRALGGHMRAHGIGDESGHIDDDDQASDWEDKLGGNVPPTNKRMYALRANPNRLKSCRVCENCGKEFLSWKSFLEHGKCSSEDAESLVSSPGSDGEDGTPRRGCGWSKRKRSLRAKVGNCPSSEEEDLANCLMMLSNATVDPLDAEPEESCASASKEEERRNSMNFIGPISMDKAKGVANKGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHMDDSLADEDHDVITHEEFFPTKSTSAMQFDHGANNNNAPLASSSKRKSKVHECSICHRVFSSGQALGGHKRCHWITSNSPDASSLPKFQQFHHDHGDQIQQRPKFIDDSDPLDLKLDLNLPAPEDDHARGGRREHVSMEVSTDIYLQPWIGVDAKEKDIDHHQHNQEINCTTSIQNNNVDDEADSKVKLAKLSEIKDMNISGGSSPWLQVGIGSTTDVDADT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query465 2.2.26 [Sep-21-2011]
O65499284 Zinc finger protein ZAT3 no no 0.410 0.672 0.344 2e-25
Q9SIJ0270 Zinc finger protein ZAT2 no no 0.376 0.648 0.314 2e-24
Q681X4286 Zinc finger protein ZAT5 no no 0.393 0.639 0.344 4e-21
Q9M202288 Zinc finger protein ZAT9 no no 0.548 0.885 0.263 1e-17
Q9SHD0314 Zinc finger protein ZAT4 no no 0.344 0.509 0.316 1e-17
Q9SSW2273 Zinc finger protein AZF2 no no 0.264 0.450 0.350 5e-15
Q39092267 Zinc finger protein ZAT1 no no 0.531 0.925 0.267 5e-13
Q42430261 Zinc finger protein 1 OS= N/A no 0.277 0.494 0.317 1e-12
Q9SSW1245 Zinc finger protein AZF1 no no 0.309 0.587 0.306 3e-12
O22533238 Zinc finger protein ZAT6 no no 0.301 0.588 0.263 4e-11
>sp|O65499|ZAT3_ARATH Zinc finger protein ZAT3 OS=Arabidopsis thaliana GN=ZAT3 PE=2 SV=1 Back     alignment and function desciption
 Score =  117 bits (293), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 114/258 (44%), Gaps = 67/258 (25%)

Query: 69  YALRANPNRLKSCRVCENCGKEFLSWKSFLEHGKCSSEDAESLVSSPGSDGEDGTPRRGC 128
           Y  + +PN  K  R C  CG++F SWK+   H +C  E     ++ P +           
Sbjct: 64  YTKKPDPNAPKITRPCTECGRKFWSWKALFGHMRCHPERQWRGINPPPNYRVPTAAS--- 120

Query: 129 GWSKRKRSLRAKVGNCPSSEEEDLANCLMMLSNATVDPLDAEPEESCASASKEEERRNSM 188
             SK+   +     +  S E+ ++A+CL+MLSN T              +S   ER    
Sbjct: 121 --SKQLNQILPNWVSFMSEEDHEVASCLLMLSNGT-------------PSSSSIER---- 161

Query: 189 NFIGPISMDKAKGVANKGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHMDDSL 248
                              FEC  CKKVF SHQALGGHRASHK VKGCFA   +  DD +
Sbjct: 162 -------------------FECGGCKKVFGSHQALGGHRASHKNVKGCFAI-TNVTDDPM 201

Query: 249 ADEDHDVITHEEFFPTKSTSAMQFDHGANNNNAPLASSSKRKSKVHECSICHRVFSSGQA 308
                          T STS+     G ++    L  S       H+C+IC RVFSSGQA
Sbjct: 202 ---------------TVSTSS-----GHDHQGKILTFSGH-----HKCNICFRVFSSGQA 236

Query: 309 LGGHKRCHWITSNSPDAS 326
           LGGH RCHW     P  S
Sbjct: 237 LGGHMRCHWEKEEEPMIS 254




Probable transcription factor that may be involved in stress responses.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SIJ0|ZAT2_ARATH Zinc finger protein ZAT2 OS=Arabidopsis thaliana GN=ZAT2 PE=2 SV=1 Back     alignment and function description
>sp|Q681X4|ZAT5_ARATH Zinc finger protein ZAT5 OS=Arabidopsis thaliana GN=ZAT5 PE=2 SV=1 Back     alignment and function description
>sp|Q9M202|ZAT9_ARATH Zinc finger protein ZAT9 OS=Arabidopsis thaliana GN=ZAT9 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHD0|ZAT4_ARATH Zinc finger protein ZAT4 OS=Arabidopsis thaliana GN=ZAT4 PE=2 SV=1 Back     alignment and function description
>sp|Q9SSW2|AZF2_ARATH Zinc finger protein AZF2 OS=Arabidopsis thaliana GN=AZF2 PE=2 SV=1 Back     alignment and function description
>sp|Q39092|ZAT1_ARATH Zinc finger protein ZAT1 OS=Arabidopsis thaliana GN=ZAT1 PE=2 SV=1 Back     alignment and function description
>sp|Q42430|ZFP1_WHEAT Zinc finger protein 1 OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|Q9SSW1|AZF1_ARATH Zinc finger protein AZF1 OS=Arabidopsis thaliana GN=AZF1 PE=2 SV=1 Back     alignment and function description
>sp|O22533|ZAT6_ARATH Zinc finger protein ZAT6 OS=Arabidopsis thaliana GN=ZAT6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query465
255541172480 conserved hypothetical protein [Ricinus 0.982 0.952 0.780 0.0
224063683478 predicted protein [Populus trichocarpa] 0.963 0.937 0.736 0.0
224129934462 predicted protein [Populus trichocarpa] 0.937 0.943 0.713 0.0
356495135481 PREDICTED: uncharacterized protein LOC10 0.961 0.929 0.711 0.0
225453527467 PREDICTED: uncharacterized protein LOC10 0.950 0.946 0.697 1e-180
357470079504 Zinc finger protein [Medicago truncatula 0.924 0.853 0.656 1e-174
63259083536 Cys2/His2 zinc-finger transcription fact 0.974 0.845 0.571 1e-144
1786142474 PEThy;ZPT4-1 [Petunia x hybrida] 0.916 0.898 0.597 1e-133
449432998525 PREDICTED: uncharacterized protein LOC10 0.883 0.782 0.476 1e-111
326529601 582 predicted protein [Hordeum vulgare subsp 0.920 0.735 0.422 1e-88
>gi|255541172|ref|XP_002511650.1| conserved hypothetical protein [Ricinus communis] gi|223548830|gb|EEF50319.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/488 (78%), Positives = 413/488 (84%), Gaps = 31/488 (6%)

Query: 1   MALIVDQQSNFKHYCKICKKGFGCGRALGGHMRAHGIGDESGHIDDDDQASDWEDKLGGN 60
           MALIVDQQ NFKH+CKICKKGFGCGRALGGHMRAHGIGDE+  +DD+D ASDWEDKLGGN
Sbjct: 1   MALIVDQQPNFKHFCKICKKGFGCGRALGGHMRAHGIGDENCQMDDEDPASDWEDKLGGN 60

Query: 61  VPPTNKRMYALRANPNRLKSCRVCENCGKEFLSWKSFLEHGKCSSEDAESLVSSPGSDGE 120
           VPP+NKRMYALR NPNRLKSCRVCENCGKEFLSWKSFLEHGKCSSEDAESLVSSP SDGE
Sbjct: 61  VPPSNKRMYALRTNPNRLKSCRVCENCGKEFLSWKSFLEHGKCSSEDAESLVSSPESDGE 120

Query: 121 DGTPRRGCGWSKRKRSLRAKVGN----CPSSEEEDLANCLMMLSNATVDPLDAEPEESCA 176
           DGT RRGCGWSKRKRSLRAKVGN    CPSSEEEDLANCLMMLSNATVDP  AEPEESCA
Sbjct: 121 DGTQRRGCGWSKRKRSLRAKVGNFNSHCPSSEEEDLANCLMMLSNATVDPFVAEPEESCA 180

Query: 177 SASKEEERRNSMNFIGPIS-----MDKAKGVANKGLFECKACKKVFNSHQALGGHRASHK 231
           SASK+EERRN MNF+ PI+     +DKAKGVA KG+FECKACKKVFNSHQALGGHRASHK
Sbjct: 181 SASKDEERRNPMNFMAPIAYRAAPVDKAKGVA-KGMFECKACKKVFNSHQALGGHRASHK 239

Query: 232 KVKGCFAARLDH-MDDSLADEDHDVITHEEFFPTKSTSAMQFDHGANNNNAPLASSSKRK 290
           KVKGCFAARLD  +DDSLADE  DVITHEEFFPTKS+S  QFDHG+   N PLAS+SKRK
Sbjct: 240 KVKGCFAARLDQGLDDSLADE--DVITHEEFFPTKSSSTFQFDHGS---NPPLASTSKRK 294

Query: 291 SKVHECSICHRVFSSGQALGGHKRCHWITSNSPDASSLPKFQQFHHDHGDQIQQRPKFID 350
           SKVHECSICHRVFSSGQALGGHKRCHWITSNSPD SSL KF QF  DH +QIQQRPKF +
Sbjct: 295 SKVHECSICHRVFSSGQALGGHKRCHWITSNSPDTSSLAKFHQF-QDHIEQIQQRPKFTN 353

Query: 351 DSDPLDLKLDLNLPAPED--DHARGGRRE----HVSMEVSTDIYLQPWIGVDAKEKDIDH 404
            S+ LDL LDLNLPAP D  DH  G +R+      S +VST+IYL+ W+GV+AKEKD +H
Sbjct: 354 TSETLDLSLDLNLPAPADHRDH-NGVKRDPPANQPSFKVSTEIYLKTWVGVEAKEKDNNH 412

Query: 405 HQHNQEINCTTSIQN-------NNVDDEADSKVKLAKLSEIKDMNISGGSSPWLQVGIGS 457
            QH  E +   +  N        NV+DEADSKVKLAKLSE+KDMN++G SSPWLQVGIGS
Sbjct: 413 QQHQNEDDNKDNNNNNNCNGSMQNVEDEADSKVKLAKLSELKDMNMNGSSSPWLQVGIGS 472

Query: 458 TTDVDADT 465
           TTDV AD+
Sbjct: 473 TTDVGADS 480




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224063683|ref|XP_002301263.1| predicted protein [Populus trichocarpa] gi|222842989|gb|EEE80536.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224129934|ref|XP_002320707.1| predicted protein [Populus trichocarpa] gi|222861480|gb|EEE99022.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356495135|ref|XP_003516436.1| PREDICTED: uncharacterized protein LOC100793846 [Glycine max] Back     alignment and taxonomy information
>gi|225453527|ref|XP_002278612.1| PREDICTED: uncharacterized protein LOC100247922 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357470079|ref|XP_003605324.1| Zinc finger protein [Medicago truncatula] gi|355506379|gb|AES87521.1| Zinc finger protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|63259083|gb|AAY40251.1| Cys2/His2 zinc-finger transcription factor [Silene latifolia] Back     alignment and taxonomy information
>gi|1786142|dbj|BAA19114.1| PEThy;ZPT4-1 [Petunia x hybrida] Back     alignment and taxonomy information
>gi|449432998|ref|XP_004134285.1| PREDICTED: uncharacterized protein LOC101222211 [Cucumis sativus] gi|449526513|ref|XP_004170258.1| PREDICTED: uncharacterized protein LOC101225110 [Cucumis sativus] Back     alignment and taxonomy information
>gi|326529601|dbj|BAK04747.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query465
TAIR|locus:2205583324 AT1G02040 "AT1G02040" [Arabido 0.255 0.367 0.492 9.2e-36
TAIR|locus:2122118284 DAZ2 "AT4G35280" [Arabidopsis 0.066 0.109 0.870 1.1e-26
TAIR|locus:2059672270 DAZ1 "AT2G17180" [Arabidopsis 0.133 0.229 0.476 2e-23
TAIR|locus:2055583314 AT2G45120 "AT2G45120" [Arabido 0.079 0.117 0.621 3.4e-20
TAIR|locus:2205649267 AT1G02030 "AT1G02030" [Arabido 0.075 0.131 0.638 1.4e-18
TAIR|locus:2197890455 AT1G26610 "AT1G26610" [Arabido 0.255 0.261 0.342 3.8e-18
TAIR|locus:2103311288 AT3G60580 "AT3G60580" [Arabido 0.165 0.267 0.379 1.6e-17
TAIR|locus:2179924362 AT5G04390 "AT5G04390" [Arabido 0.427 0.549 0.309 2.8e-16
TAIR|locus:2083053215 AT3G49930 "AT3G49930" [Arabido 0.070 0.153 0.606 1.6e-15
TAIR|locus:2046153286 AT2G28200 "AT2G28200" [Arabido 0.309 0.503 0.311 6e-15
TAIR|locus:2205583 AT1G02040 "AT1G02040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 307 (113.1 bits), Expect = 9.2e-36, Sum P(2) = 9.2e-36
 Identities = 66/134 (49%), Positives = 80/134 (59%)

Query:   207 LFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHMDDSLADEDHDVITHEEFFPTKS 266
             +F+CKACKKVF SHQALGGHRASHKKVKGCFA++     D   +E+      EE+     
Sbjct:   149 VFQCKACKKVFTSHQALGGHRASHKKVKGCFASQ-----DKEEEEE------EEYKEDDD 197

Query:   267 TSAMQFDHGXXXXXXXXXXXXKRKSKVHECSICHRVFSSGQALGGHKRCHWIT-SNSPDA 325
              +    D              +++S  HEC+ICHRVFSSGQALGGHKRCHW+T SN    
Sbjct:   198 DNDEDEDEEEDEEDKSTAHIARKRSNAHECTICHRVFSSGQALGGHKRCHWLTPSNYLRM 257

Query:   326 SSLPKFQQFHHDHG 339
             +SL      HH  G
Sbjct:   258 TSL---HDHHHSVG 268


GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
TAIR|locus:2122118 DAZ2 "AT4G35280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059672 DAZ1 "AT2G17180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055583 AT2G45120 "AT2G45120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205649 AT1G02030 "AT1G02030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197890 AT1G26610 "AT1G26610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103311 AT3G60580 "AT3G60580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179924 AT5G04390 "AT5G04390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083053 AT3G49930 "AT3G49930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046153 AT2G28200 "AT2G28200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00021325
hypothetical protein (478 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query465
pfam1391227 pfam13912, zf-C2H2_6, C2H2-type zinc finger 5e-07
pfam1391227 pfam13912, zf-C2H2_6, C2H2-type zinc finger 2e-05
>gnl|CDD|206083 pfam13912, zf-C2H2_6, C2H2-type zinc finger Back     alignment and domain information
 Score = 45.7 bits (109), Expect = 5e-07
 Identities = 15/25 (60%), Positives = 18/25 (72%)

Query: 293 VHECSICHRVFSSGQALGGHKRCHW 317
           VH C +C + FSS QALGGHK+ H 
Sbjct: 1   VHTCGVCGKTFSSLQALGGHKKSHC 25


Length = 27

>gnl|CDD|206083 pfam13912, zf-C2H2_6, C2H2-type zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 465
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.94
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.91
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.85
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.82
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.82
KOG3608467 consensus Zn finger proteins [General function pre 99.81
KOG3608467 consensus Zn finger proteins [General function pre 99.71
KOG3576267 consensus Ovo and related transcription factors [T 99.65
KOG3576267 consensus Ovo and related transcription factors [T 99.52
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.37
PLN03086567 PRLI-interacting factor K; Provisional 99.13
PHA00733128 hypothetical protein 98.94
KOG3993500 consensus Transcription factor (contains Zn finger 98.82
PHA0276855 hypothetical protein; Provisional 98.81
PHA0276855 hypothetical protein; Provisional 98.66
PLN03086567 PRLI-interacting factor K; Provisional 98.6
PHA00733128 hypothetical protein 98.56
KOG3993500 consensus Transcription factor (contains Zn finger 98.43
PHA0073279 hypothetical protein 98.24
PHA0061644 hypothetical protein 98.21
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.18
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.13
PHA0073279 hypothetical protein 97.95
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.92
PHA0061644 hypothetical protein 97.86
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.78
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.67
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.63
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.49
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.46
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.37
COG5189423 SFP1 Putative transcriptional repressor regulating 97.3
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.27
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.18
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.14
smart0035526 ZnF_C2H2 zinc finger. 96.95
COG5189423 SFP1 Putative transcriptional repressor regulating 96.93
smart0035526 ZnF_C2H2 zinc finger. 96.7
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.66
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.5
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 96.48
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.3
COG5048467 FOG: Zn-finger [General function prediction only] 96.05
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.04
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.94
PRK04860160 hypothetical protein; Provisional 95.71
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.71
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.69
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 94.53
KOG1146 1406 consensus Homeobox protein [General function predi 94.35
KOG2893 341 consensus Zn finger protein [General function pred 94.01
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.87
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 93.31
COG5048467 FOG: Zn-finger [General function prediction only] 92.55
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.43
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.33
PRK04860160 hypothetical protein; Provisional 91.85
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.49
KOG11461406 consensus Homeobox protein [General function predi 90.02
KOG2893341 consensus Zn finger protein [General function pred 89.95
COG5236493 Uncharacterized conserved protein, contains RING Z 89.45
KOG2785390 consensus C2H2-type Zn-finger protein [General fun 87.14
PF09986214 DUF2225: Uncharacterized protein conserved in bact 85.93
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 84.86
KOG2785390 consensus C2H2-type Zn-finger protein [General fun 84.73
COG5236493 Uncharacterized conserved protein, contains RING Z 82.76
COG404965 Uncharacterized protein containing archaeal-type C 82.22
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.94  E-value=1e-27  Score=217.43  Aligned_cols=139  Identities=24%  Similarity=0.430  Sum_probs=124.8

Q ss_pred             CCceeccCcccCcCCCccchhhhhhhcccCCcccCCCcCcccCcCcccCCCCCCCCCCcceecccCCCCCCCcccCCccc
Q 040791            9 SNFKHYCKICKKGFGCGRALGGHMRAHGIGDESGHIDDDDQASDWEDKLGGNVPPTNKRMYALRANPNRLKSCRVCENCG   88 (465)
Q Consensus         9 ~~~~~~C~~C~k~F~~~~~L~~H~r~H~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~lr~~~~~~~~~y~C~~Cg   88 (465)
                      ...+|+|..|||.+.+.++|.+|..+|.        +           +      ...+.+             .|++||
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~--------~-----------~------~s~ka~-------------~C~~C~  168 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHR--------S-----------L------DSKKAF-------------SCKYCG  168 (279)
T ss_pred             cCCceeccccccccccccccchhhcccc--------c-----------c------cccccc-------------cCCCCC
Confidence            5677999999999999999999999994        1           0      123445             899999


Q ss_pred             ccccChHHHHHhhhhCCCccCcCCCCCCCCCCCCCCCCCCCCCccccccccccCCCCCCchhHHHHHHHHhhccCCCCCC
Q 040791           89 KEFLSWKSFLEHGKCSSEDAESLVSSPGSDGEDGTPRRGCGWSKRKRSLRAKVGNCPSSEEEDLANCLMMLSNATVDPLD  168 (465)
Q Consensus        89 k~F~~~~~L~~H~r~H~ge~~~~~~~~~~~~e~~~~c~~c~~~~~~~s~~~~~~~~~~~eee~~a~~l~~l~~~~~~~~~  168 (465)
                      |.|.+...|+.|+|+|+                                                               
T Consensus       169 K~YvSmpALkMHirTH~---------------------------------------------------------------  185 (279)
T KOG2462|consen  169 KVYVSMPALKMHIRTHT---------------------------------------------------------------  185 (279)
T ss_pred             ceeeehHHHhhHhhccC---------------------------------------------------------------
Confidence            99999999999999997                                                               


Q ss_pred             CCCCCcccccchhhhhhccccccCCccccccccccCCCcccccccccccCChhhhhhhhhhcCCCCcccCCCCCCcCCCc
Q 040791          169 AEPEESCASASKEEERRNSMNFIGPISMDKAKGVANKGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHMDDSL  248 (465)
Q Consensus       169 ~~~~~~C~~c~k~f~~~~~l~~~~~~~~~~~~~~~~~k~y~C~~Cgk~F~~~~~L~~H~~~H~~~k~~~C~~C~~~f~~~  248 (465)
                                                           -+++|.+|||.|.+...|++|+|+|+|||||.|+.|+++|...
T Consensus       186 -------------------------------------l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADR  228 (279)
T KOG2462|consen  186 -------------------------------------LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADR  228 (279)
T ss_pred             -------------------------------------CCcccccccccccchHHhhcccccccCCCCccCCcccchhcch
Confidence                                                 1489999999999999999999999999999999999999999


Q ss_pred             chhhhhhhhcccccCCCcchhhHhhhcCCCCCCcccccccCCCCceecCccccccCCchhhhhhhhh
Q 040791          249 ADEDHDVITHEEFFPTKSTSAMQFDHGANNNNAPLASSSKRKSKVHECSICHRVFSSGQALGGHKRC  315 (465)
Q Consensus       249 ~~l~~H~~~H~~~~~~~~~s~~l~~H~~~~~~~~~~~~~h~~ekp~~C~~Cgk~F~~~~~L~~H~r~  315 (465)
                      ++|+.|+.+|.+                              .|+|+|..|+|+|+.++.|.+|...
T Consensus       229 SNLRAHmQTHS~------------------------------~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  229 SNLRAHMQTHSD------------------------------VKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             HHHHHHHHhhcC------------------------------CccccCcchhhHHHHHHHHHHhhhh
Confidence            999999999866                              6899999999999999999999764



>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query465
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 2e-07
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 3e-07
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 2e-05
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
 Score = 46.3 bits (110), Expect = 2e-07
 Identities = 13/26 (50%), Positives = 15/26 (57%)

Query: 291 SKVHECSICHRVFSSGQALGGHKRCH 316
            + + CS C R F S QALGGH   H
Sbjct: 4   PRSYTCSFCKREFRSAQALGGHMNVH 29


>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query465
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.93
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.87
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.87
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.84
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.83
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.83
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.82
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.81
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.8
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.76
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.74
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.74
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.74
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.73
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.72
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.72
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.72
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.7
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.7
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.7
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.68
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.66
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.66
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.65
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.65
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.65
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.64
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.64
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.64
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.62
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.6
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.58
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.56
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.55
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.55
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.53
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.53
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.51
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.5
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.49
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.48
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.46
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.44
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.44
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.43
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.43
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.43
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.42
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.42
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.42
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.41
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.41
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.41
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.4
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.4
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.4
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.39
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.38
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.37
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.36
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.35
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.32
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.3
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.3
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.3
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.28
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.25
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.25
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.23
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.23
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.2
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.18
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.18
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.17
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.16
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.14
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.14
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.03
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.03
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.02
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.0
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.98
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.97
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.96
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.95
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.94
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.93
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.93
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.93
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.91
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.91
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.91
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.9
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.9
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.89
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.88
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.88
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.87
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.87
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.86
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.86
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.86
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.86
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.85
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.85
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.85
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.84
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.84
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.84
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.84
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.84
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.84
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.84
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.84
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.84
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.83
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.83
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.83
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.82
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.82
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.82
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.81
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.8
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.8
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.79
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.79
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.79
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.78
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.78
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.78
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.77
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.77
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.73
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.69
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.69
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.68
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.68
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.67
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.67
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.66
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.66
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.66
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.66
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.66
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.66
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.66
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.66
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.65
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.65
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.65
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.64
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.64
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.64
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.64
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.64
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.63
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.63
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.63
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.63
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.62
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.62
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.62
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.62
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.62
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.61
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.61
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.61
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.6
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.59
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.59
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.57
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.56
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.56
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.56
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.55
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.55
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.54
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.54
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.54
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.54
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.53
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.53
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.53
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.52
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.52
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.51
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.51
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.51
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.5
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.5
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.5
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.49
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.47
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.41
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.41
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.4
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.4
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.39
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.39
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.38
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.35
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.34
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.32
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.31
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.31
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.3
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.28
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.27
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.26
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.25
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.25
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.25
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.24
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.24
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.56
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.23
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.23
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.55
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.54
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.22
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.21
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.2
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.2
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.19
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.18
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.15
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.15
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.15
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.44
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.15
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.14
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.14
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.13
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.42
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.11
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.11
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.09
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.08
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.08
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.05
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.0
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.23
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.77
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.79
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.76
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.45
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.04
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 95.53
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.29
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.56
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.4
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.22
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 88.97
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 85.51
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 82.13
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 82.04
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 80.38
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.97  E-value=2.1e-33  Score=254.67  Aligned_cols=171  Identities=23%  Similarity=0.398  Sum_probs=121.8

Q ss_pred             CCCceeccCcccCcCCCccchhhhhhhcccCCcccCCCcCcccCcCcccCCCCCCCCCCcceecccCCCCCCCcccCCcc
Q 040791            8 QSNFKHYCKICKKGFGCGRALGGHMRAHGIGDESGHIDDDDQASDWEDKLGGNVPPTNKRMYALRANPNRLKSCRVCENC   87 (465)
Q Consensus         8 ~~~~~~~C~~C~k~F~~~~~L~~H~r~H~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~lr~~~~~~~~~y~C~~C   87 (465)
                      .++++|.|.+|++.|.....|..|++.|                            .++++|             .|+.|
T Consensus        17 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h----------------------------~~~~~~-------------~C~~C   55 (190)
T 2i13_A           17 PGEKPYACPECGKSFSRSDHLAEHQRTH----------------------------TGEKPY-------------KCPEC   55 (190)
T ss_dssp             --------------CCSSHHHHHGGGCC-------------------------------CCE-------------ECTTT
T ss_pred             CCCCCCcCCCCccccCCHHHHHHHHHHc----------------------------CCCCCc-------------cCCCc
Confidence            3456677777777777777777777777                            455666             67777


Q ss_pred             cccccChHHHHHhhhhCCCccCcCCCCCCCCCCCCCCCCCCCCCccccccccccCCCCCCchhHHHHHHHHhhccCCCCC
Q 040791           88 GKEFLSWKSFLEHGKCSSEDAESLVSSPGSDGEDGTPRRGCGWSKRKRSLRAKVGNCPSSEEEDLANCLMMLSNATVDPL  167 (465)
Q Consensus        88 gk~F~~~~~L~~H~r~H~ge~~~~~~~~~~~~e~~~~c~~c~~~~~~~s~~~~~~~~~~~eee~~a~~l~~l~~~~~~~~  167 (465)
                      ++.|.+...|..|++.|.++++                                                          
T Consensus        56 ~~~f~~~~~l~~H~~~h~~~~~----------------------------------------------------------   77 (190)
T 2i13_A           56 GKSFSDKKDLTRHQRTHTGEKP----------------------------------------------------------   77 (190)
T ss_dssp             CCEESSHHHHHHHHHHHHCCCC----------------------------------------------------------
T ss_pred             CchhCCHHHHHHHHHhcCCCCC----------------------------------------------------------
Confidence            7777777777777777664432                                                          


Q ss_pred             CCCCCCcccccchhhhhhccccccCCccccccccccCCCcccccccccccCChhhhhhhhhhcCCCCcccCCCCCCcCCC
Q 040791          168 DAEPEESCASASKEEERRNSMNFIGPISMDKAKGVANKGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHMDDS  247 (465)
Q Consensus       168 ~~~~~~~C~~c~k~f~~~~~l~~~~~~~~~~~~~~~~~k~y~C~~Cgk~F~~~~~L~~H~~~H~~~k~~~C~~C~~~f~~  247 (465)
                           |.|..|++.|.....|.       .|...|.++++|.|++|++.|.+...|..|+++|.++++|.|..|++.|..
T Consensus        78 -----~~C~~C~~~f~~~~~l~-------~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  145 (190)
T 2i13_A           78 -----YKCPECGKSFSQRANLR-------AHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSR  145 (190)
T ss_dssp             -----EECTTTCCEESCHHHHH-------HHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESC
T ss_pred             -----ccCcccCCccCCHHHHH-------HHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCC
Confidence                 44445555444444443       445555677889999999999999999999999999999999999999999


Q ss_pred             cchhhhhhhhcccccCCCcchhhHhhhcCCCCCCcccccccCCCCceecCccccccCCchhhhhhhhhccCC
Q 040791          248 LADEDHDVITHEEFFPTKSTSAMQFDHGANNNNAPLASSSKRKSKVHECSICHRVFSSGQALGGHKRCHWIT  319 (465)
Q Consensus       248 ~~~l~~H~~~H~~~~~~~~~s~~l~~H~~~~~~~~~~~~~h~~ekp~~C~~Cgk~F~~~~~L~~H~r~H~~~  319 (465)
                      ...|..|+++|.+                              ++||.|++|++.|.+...|..|+++|+++
T Consensus       146 ~~~L~~H~~~H~~------------------------------~~~~~C~~C~~~f~~~~~L~~H~~~H~~~  187 (190)
T 2i13_A          146 EDNLHTHQRTHTG------------------------------EKPYKCPECGKSFSRRDALNVHQRTHTGK  187 (190)
T ss_dssp             HHHHHHHHHHHHC------------------------------CCCEECTTTCCEESSHHHHHHHHTTC---
T ss_pred             HHHHHHHHHhcCC------------------------------CCCeECCCCCCccCCHHHHHHHHHhcCCC
Confidence            9999999988855                              78999999999999999999999999865



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 465
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 1e-10
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 1e-08
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 5e-08
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Plant C2H2 finger (QALGGH zinc finger)
domain: SUPERMAN zinc finger domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 53.9 bits (130), Expect = 1e-10
 Identities = 13/26 (50%), Positives = 15/26 (57%)

Query: 291 SKVHECSICHRVFSSGQALGGHKRCH 316
            + + CS C R F S QALGGH   H
Sbjct: 3   PRSYTCSFCKREFRSAQALGGHMNVH 28


>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query465
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.62
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.46
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.32
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.27
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.26
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.2
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.17
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.14
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.12
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.12
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.1
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.03
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.03
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.0
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.0
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.98
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.98
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.96
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.95
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.93
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.91
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.83
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.82
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.8
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.8
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.78
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.75
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.74
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.67
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.67
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.65
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.65
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.63
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.63
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.61
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.6
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.56
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.48
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.42
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.39
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.37
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.35
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.35
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.3
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.29
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.27
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.19
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.08
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.83
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.81
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.8
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.77
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.73
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.72
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.65
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.65
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.63
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.62
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.55
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.49
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.44
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.34
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.33
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.28
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.26
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.17
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.13
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.02
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.0
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.9
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.68
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.66
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.56
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.5
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.45
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.34
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.32
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.27
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.21
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.07
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.04
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.87
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.84
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.37
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.28
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.95
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.66
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.63
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.62
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.08
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.05
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.03
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.95
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 93.93
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 93.59
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.88
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 92.87
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.67
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.41
d1y0jb136 U-shaped transcription factor, different fingers { 90.17
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 89.64
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.63
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.59
d1y0jb136 U-shaped transcription factor, different fingers { 88.27
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.1
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 87.24
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 86.97
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 86.79
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.65
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 84.76
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 84.53
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 83.89
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 83.51
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.62  E-value=7.1e-17  Score=111.62  Aligned_cols=53  Identities=26%  Similarity=0.577  Sum_probs=48.8

Q ss_pred             CCcccccccccccCChhhhhhhhhhcCCCCcccCCCCCCcCCCcchhhhhhhhcccccCCCcchhhHhhhcCCCCCCccc
Q 040791          205 KGLFECKACKKVFNSHQALGGHRASHKKVKGCFAARLDHMDDSLADEDHDVITHEEFFPTKSTSAMQFDHGANNNNAPLA  284 (465)
Q Consensus       205 ~k~y~C~~Cgk~F~~~~~L~~H~~~H~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~~~s~~l~~H~~~~~~~~~~  284 (465)
                      |++|+|+ |||+|.....|..|+++|++                                                    
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~----------------------------------------------------   27 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLG----------------------------------------------------   27 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSC----------------------------------------------------
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhcccc----------------------------------------------------
Confidence            5799995 99999999999999999988                                                    


Q ss_pred             ccccCCCCceecCccccccCCchhhhhhhhhc
Q 040791          285 SSSKRKSKVHECSICHRVFSSGQALGGHKRCH  316 (465)
Q Consensus       285 ~~~h~~ekp~~C~~Cgk~F~~~~~L~~H~r~H  316 (465)
                            ++||.|.+||++|.+...|..|||+|
T Consensus        28 ------ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1          28 ------LRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             ------CCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             ------ccCCcCCCcCCEecCHHHHHHHHhcC
Confidence                  67899999999999999999999988



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure