BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 040802
(245 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|A5EW88|SYA_DICNV Alanine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A)
GN=alaS PE=3 SV=1
Length = 873
Score = 33.5 bits (75), Expect = 1.2, Method: Compositional matrix adjust.
Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 6/71 (8%)
Query: 115 GYVVAFAGRKYAARSAPTLVADSTHTVTNLTLVLEFQQ----GTLENLYWKSLGCDS--C 168
GY ++ A+++ T AD T+TV+ T L +QQ T+E ++ + D+ C
Sbjct: 424 GYEALMQAQRERAKASGTFRADKTYTVSGKTAFLAYQQEQTESTIEAIFVQEQAADTLDC 483
Query: 169 SGETSVCINNT 179
E + +N +
Sbjct: 484 GDEAVLVLNQS 494
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.322 0.136 0.418
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 89,052,991
Number of Sequences: 539616
Number of extensions: 3545380
Number of successful extensions: 6686
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 6682
Number of HSP's gapped (non-prelim): 7
length of query: 245
length of database: 191,569,459
effective HSP length: 114
effective length of query: 131
effective length of database: 130,053,235
effective search space: 17036973785
effective search space used: 17036973785
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)