Citrus Sinensis ID: 040832


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720----
MEDNNQSPGVSNSPDAAETPPSPSRASSSPPPSTPPSDESPPPSSPPPSSPPPDRSPPPSSPPPSPESPPPSSPPPSSQSPPQSPPPPNSKSPPQSSPPPNTNPPPQSSPPPSNSNASPPPSQDNPSDPPPGDSNNGSSPPGNNNNNNNNGKGNGNGNGNHNNNNNNNNNKNWHPPPPPSSSSNSPNGNRSGALSPPNKSNGSSSSPSSNNGSMLSIPLVAAVAAGAAFLIIVMLLVFFACRRKKNRERNDQMPYYNNNHTTATDYYNSAATPSPPPRANWQQQTDHGWPTPPPSQRGAVTVTSSDMSHNSSSGPYGPVLPPPPPIVALGFSQSAFTYEELSAATGGFSQSNLLGQGGFGYVHKGVLPNGKEVAVKSLRSGSGQGEREFKAEVEIISRVHHRHLVSLVGYCIAGGKRLLVYEYVPNNNLEFHLHGKGRPVMDWPTRLKIAMGSAKGLAYLHEDCHPRIIHRDIKSSNILLDYTFETKVADFGLAKLTTDNNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPIDPTGAMEDCLVDWARPLCLRALDDGNFNEIADPYLEKNYPTEEMARMVACAAASIRHSARRRPKISQIVRALEGDVSLEDLNDGIKPSQASILGGGTANSSAVGSASARSSDVDNISYTEDLKKLRRMAEGNASGAYVSSEYGATSEYGLNPSSSSSEFGSRGQSPNTKVKSSFRK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccCEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHccccccccEEEEEccccEEEEEEEEcccccHHHHHcccccccccHHHHHHHHHcccccHHHHcccccccCCccccccccccccccccccccccccccccccccccCCcccccccccccHHHHccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccc
**********************************************************************************************************************************************************************************************************************LSIPLVAAVAAGAAFLIIVMLLVFFACRRK*************************************************************************************GFSQSAFTYEELSAATGGFSQSNLLGQGGFGYVHKGVLPNGKEVAVKSLRSG***GEREFKAEVEIISRVHHRHLVSLVGYCIAGGKRLLVYEYVPNNNLEFHLHGKGRPVMDWPTRLKIAMGSAKGLAYLHEDCHPRIIHRDIKSSNILLDYTFETKVADFGLAKLTTDNNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPIDPTGAMEDCLVDWARPLCLRALDDGNFNEIADPYLEKNYPTEEMARMVACAAASIRHSARRRPKISQIVRALEGDVSL**************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDNNQSPGVSNSPDAAETPPSPSRASSSPPPSTPPSDESPPPSSPPPSSPPPDRSPPPSSPPPSPESPPPSSPPPSSQSPPQSPPPPNSKSPPQSSPPPNTNPPPQSSPPPSNSNASPPPSQDNPSDPPPGDSNNGSSPPGNNNNNNNNGKGNGNGNGNHNNNNNNNNNKNWHPPPPPSSSSNSPNGNRSGALSPPNKSNGSSSSPSSNNGSMLSIPLVAAVAAGAAFLIIVMLLVFFACRRKKNRERNDQMPYYNNNHTTATDYYNSAATPSPPPRANWQQQTDHGWPTPPPSQRGAVTVTSSDMSHNSSSGPYGPVLPPPPPIVALGFSQSAFTYEELSAATGGFSQSNLLGQGGFGYVHKGVLPNGKEVAVKSLRSGSGQGEREFKAEVEIISRVHHRHLVSLVGYCIAGGKRLLVYEYVPNNNLEFHLHGKGRPVMDWPTRLKIAMGSAKGLAYLHEDCHPRIIHRDIKSSNILLDYTFETKVADFGLAKLTTDNNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPIDPTGAMEDCLVDWARPLCLRALDDGNFNEIADPYLEKNYPTEEMARMVACAAASIRHSARRRPKISQIVRALEGDVSLEDLNDGIKPSQASILGGGTANSSAVGSASARSSDVDNISYTEDLKKLRRMAEGNASGAYVSSEYGATSEYGLNPSSSSSEFGSRGQSPNTKVKSSFRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proline-rich receptor-like protein kinase PERK7 probableQ9XI96

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H8H, chain A
Confidence level:very confident
Coverage over the Query: 342-625
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 334-625
View the alignment between query and template
View the model in PyMOL
Template: 3PGW, chain B
Confidence level:probable
Coverage over the Query: 3-14
View the alignment between query and template
View the model in PyMOL
Template: 2K1K, chain A
Confidence level:probable
Coverage over the Query: 212-220
View the alignment between query and template
View the model in PyMOL
Template: 3GDB, chain A
Confidence level:probable
Coverage over the Query: 153-208
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3ghg, chain Aprobable Alignment | Template Structure