BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 040837
(276 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1JB0|B Chain B, Crystal Structure Of Photosystem I: A Photosynthetic
Reaction Center And Core Antenna System From
Cyanobacteria
pdb|3PCQ|B Chain B, Femtosecond X-Ray Protein Nanocrystallography
pdb|4FE1|B Chain B, Improving The Accuracy Of Macromolecular Structure
Refinement At 7 A Resolution
Length = 740
Score = 31.2 bits (69), Expect = 0.63, Method: Compositional matrix adjust.
Identities = 20/68 (29%), Positives = 28/68 (41%), Gaps = 8/68 (11%)
Query: 27 LDRFRNHPSRRTCKFTCL-LHVGFEDIAQVVHNKVLIAAG-------VSAAIGQLSKPVT 78
LDR H + + L +GF + VHN V++A G + Q +
Sbjct: 411 LDRVLQHKEAIISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQFIQAAH 470
Query: 79 GSLLYGKD 86
G LLYG D
Sbjct: 471 GKLLYGFD 478
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.131 0.369
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,079,227
Number of Sequences: 62578
Number of extensions: 261874
Number of successful extensions: 533
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 533
Number of HSP's gapped (non-prelim): 2
length of query: 276
length of database: 14,973,337
effective HSP length: 97
effective length of query: 179
effective length of database: 8,903,271
effective search space: 1593685509
effective search space used: 1593685509
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)