BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 040848
         (641 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3KZU|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein)
           Synthase Ii From Brucella Melitensis
 pdb|3KZU|B Chain B, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein)
           Synthase Ii From Brucella Melitensis
 pdb|3KZU|C Chain C, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein)
           Synthase Ii From Brucella Melitensis
          Length = 428

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 83  VLRGDRIENSVYEFEMREDLSCKVACRVKV 112
           +L G+     V EFE+ +DL+C++ACR+ V
Sbjct: 34  LLAGESGARRVTEFEV-DDLACQIACRIPV 62


>pdb|2ZT9|B Chain B, Crystal Structure Of The Cytochrome B6f Complex From
           Nostoc Sp. Pcc 7120
 pdb|4H44|B Chain B, 2.70 A Cytochrome B6f Complex Structure From Nostoc Pcc
           7120
          Length = 160

 Score = 29.6 bits (65), Expect = 5.6,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 15/73 (20%)

Query: 461 PLVFVGSYLGFKKPAIEDPVKTNK------IPRQI-PEQAWYMTPVFSIL------IGGI 507
           P+V +GS+      A+ DP  T +       P +I PE  WY+ PVF IL      + G+
Sbjct: 41  PIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPE--WYLYPVFQILRSLPNKLLGV 98

Query: 508 LPFGAVFIELFFI 520
           L   +V + L  +
Sbjct: 99  LAMASVPLGLILV 111


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.140    0.440 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,782,144
Number of Sequences: 62578
Number of extensions: 704711
Number of successful extensions: 1616
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 14
Number of HSP's that attempted gapping in prelim test: 1616
Number of HSP's gapped (non-prelim): 14
length of query: 641
length of database: 14,973,337
effective HSP length: 105
effective length of query: 536
effective length of database: 8,402,647
effective search space: 4503818792
effective search space used: 4503818792
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)