Citrus Sinensis ID: 040854

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MAKSFAIFILALFAISMLQTMVVAANGQGGRHYDSKHYGPGTVKSYQCPGKCDTRCSQTQYRKPCLFFCNKCCKKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP
cccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccc
**KSFAIFILALFAISMLQTMVVAAN***************TVKSYQCPGKCDTRCSQTQYRKPCLFFCNKCCKKCLCVPPGYYGNKAVCPCYNNWKT********
xxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKSFAIFILALFAISMLQTMVVAANGQGGRHYDSKHYGPGTVKSYQCPGKCDTRCSQTQYRKPCLFFCNKCCKKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gibberellin-regulated protein 4 Gibberellin-regulated protein involved in the regulation of floral meristem and floral organ identity, and promotion of seed size and weight. May play a role in the promotion of gibberellin responses such as regulation of flowering under short-day conditions, seed germination and inhibition of gibberellin oxidase. Possesses redox activity in E.coli and may function in redox regulation in planta.probableP46690

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted