BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 040903
(357 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q3V4S8|Y082_ATV Uncharacterized protein ORF82 OS=Acidianus two-tailed virus PE=4
SV=1
Length = 82
Score = 37.0 bits (84), Expect = 0.21, Method: Composition-based stats.
Identities = 23/64 (35%), Positives = 39/64 (60%), Gaps = 3/64 (4%)
Query: 269 FEDKAAEKEEEDKEDDDHEEEEEEEEVTQVKKTKN-LKSLMEEEKRNNKENLVVMAYD-T 326
F++KA E E++D ED +EEE+ VT + K N LK + ++ K+ E L+V+ +
Sbjct: 4 FDNKAQENEQQD-EDPGTRTKEEEKNVTSIYKNINFLKKIFDQSKKEGIEYLIVLGKNFA 62
Query: 327 DFYK 330
D+Y+
Sbjct: 63 DYYR 66
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.312 0.127 0.380
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 146,693,357
Number of Sequences: 539616
Number of extensions: 6581991
Number of successful extensions: 114118
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 1281
Number of HSP's successfully gapped in prelim test: 928
Number of HSP's that attempted gapping in prelim test: 70351
Number of HSP's gapped (non-prelim): 24174
length of query: 357
length of database: 191,569,459
effective HSP length: 119
effective length of query: 238
effective length of database: 127,355,155
effective search space: 30310526890
effective search space used: 30310526890
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 62 (28.5 bits)