BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 040903
         (357 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q3V4S8|Y082_ATV Uncharacterized protein ORF82 OS=Acidianus two-tailed virus PE=4
           SV=1
          Length = 82

 Score = 37.0 bits (84), Expect = 0.21,   Method: Composition-based stats.
 Identities = 23/64 (35%), Positives = 39/64 (60%), Gaps = 3/64 (4%)

Query: 269 FEDKAAEKEEEDKEDDDHEEEEEEEEVTQVKKTKN-LKSLMEEEKRNNKENLVVMAYD-T 326
           F++KA E E++D ED     +EEE+ VT + K  N LK + ++ K+   E L+V+  +  
Sbjct: 4   FDNKAQENEQQD-EDPGTRTKEEEKNVTSIYKNINFLKKIFDQSKKEGIEYLIVLGKNFA 62

Query: 327 DFYK 330
           D+Y+
Sbjct: 63  DYYR 66


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.312    0.127    0.380 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 146,693,357
Number of Sequences: 539616
Number of extensions: 6581991
Number of successful extensions: 114118
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 1281
Number of HSP's successfully gapped in prelim test: 928
Number of HSP's that attempted gapping in prelim test: 70351
Number of HSP's gapped (non-prelim): 24174
length of query: 357
length of database: 191,569,459
effective HSP length: 119
effective length of query: 238
effective length of database: 127,355,155
effective search space: 30310526890
effective search space used: 30310526890
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 62 (28.5 bits)