BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 040983
         (74 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3B6I|A Chain A, Wrba From Escherichia Coli, Native Structure
 pdb|3B6I|B Chain B, Wrba From Escherichia Coli, Native Structure
 pdb|3B6J|A Chain A, Wrba From Escherichia Coli, Nadh Complex
 pdb|3B6J|B Chain B, Wrba From Escherichia Coli, Nadh Complex
 pdb|3B6K|A Chain A, Wrba From Escherichia Coli, Benzoquinone Complex
 pdb|3B6K|B Chain B, Wrba From Escherichia Coli, Benzoquinone Complex
 pdb|3B6M|A Chain A, Wrba From Escherichia Coli, Second Crystal Form
 pdb|3B6M|B Chain B, Wrba From Escherichia Coli, Second Crystal Form
 pdb|2R96|A Chain A, Crystal Structure Of E. Coli Wrba In Complex With Fmn
 pdb|2R96|C Chain C, Crystal Structure Of E. Coli Wrba In Complex With Fmn
 pdb|2R97|A Chain A, Crystal Structure Of E. Coli Wrba In Complex With Fmn
 pdb|2R97|C Chain C, Crystal Structure Of E. Coli Wrba In Complex With Fmn
 pdb|2RG1|A Chain A, Crystal Structure Of E. Coli Wrba Apoprotein
 pdb|2RG1|B Chain B, Crystal Structure Of E. Coli Wrba Apoprotein
          Length = 198

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 2/70 (2%)

Query: 5   TQLAHHDMLFLPLGYNFGRGMFKLDEVKGGSSYGAGRFAA-DGSRQPAELELEQAFHQGE 63
           T LAHH M+ +P+GY   + +F + +V+GG+ YGA   A  DGSRQP++ EL  A +QGE
Sbjct: 129 TTLAHHGMVIVPIGYA-AQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGE 187

Query: 64  YVGEIAKELK 73
           YV  +A +L 
Sbjct: 188 YVAGLAVKLN 197


>pdb|2ZKI|A Chain A, Crystal Structure Of Hypothetical Trp Repressor Binding
           Protein From Sul Folobus Tokodaii (St0872)
 pdb|2ZKI|B Chain B, Crystal Structure Of Hypothetical Trp Repressor Binding
           Protein From Sul Folobus Tokodaii (St0872)
 pdb|2ZKI|C Chain C, Crystal Structure Of Hypothetical Trp Repressor Binding
           Protein From Sul Folobus Tokodaii (St0872)
 pdb|2ZKI|D Chain D, Crystal Structure Of Hypothetical Trp Repressor Binding
           Protein From Sul Folobus Tokodaii (St0872)
 pdb|2ZKI|E Chain E, Crystal Structure Of Hypothetical Trp Repressor Binding
           Protein From Sul Folobus Tokodaii (St0872)
 pdb|2ZKI|F Chain F, Crystal Structure Of Hypothetical Trp Repressor Binding
           Protein From Sul Folobus Tokodaii (St0872)
 pdb|2ZKI|G Chain G, Crystal Structure Of Hypothetical Trp Repressor Binding
           Protein From Sul Folobus Tokodaii (St0872)
 pdb|2ZKI|H Chain H, Crystal Structure Of Hypothetical Trp Repressor Binding
           Protein From Sul Folobus Tokodaii (St0872)
          Length = 199

 Score = 32.3 bits (72), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 7/74 (9%)

Query: 1   LTAVTQLAHHDMLFLPLGYNFGRGMFKLDEVKGGSSYGAGRFAADGSRQPA-ELELEQAF 59
           LT  T   H  M+ +P+GY     +F+     GG  YGA      GS++   E+E + A 
Sbjct: 128 LTMSTYAYHFGMIIVPIGYGIPE-LFQ--TTTGGGPYGATHL---GSKEELDEMERKIAR 181

Query: 60  HQGEYVGEIAKELK 73
            QG+ + E+AK +K
Sbjct: 182 FQGKRITEVAKAIK 195


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.138    0.404 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,506,490
Number of Sequences: 62578
Number of extensions: 92465
Number of successful extensions: 166
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 152
Number of HSP's gapped (non-prelim): 13
length of query: 74
length of database: 14,973,337
effective HSP length: 44
effective length of query: 30
effective length of database: 12,219,905
effective search space: 366597150
effective search space used: 366597150
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)