BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 041075
         (181 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1OXW|A Chain A, The Crystal Structure Of Semet Patatin
 pdb|1OXW|B Chain B, The Crystal Structure Of Semet Patatin
 pdb|1OXW|C Chain C, The Crystal Structure Of Semet Patatin
          Length = 373

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%)

Query: 95  FRSIASENNYLRFQDNSLSGDAPSTDKAIEKEMQELAKIGERLLKKPVSR 144
           F+++ S+NNYLR Q+N+L+G     D A E   + L ++GE LLKKPVS 
Sbjct: 294 FQALDSKNNYLRVQENALTGTTTEXDDASEANXELLVQVGENLLKKPVSE 343


>pdb|1UIJ|A Chain A, Crystal Structure Of Soybean Beta-Conglycinin Beta
           Homotrimer (I122mK124W)
 pdb|1UIJ|B Chain B, Crystal Structure Of Soybean Beta-Conglycinin Beta
           Homotrimer (I122mK124W)
 pdb|1UIJ|C Chain C, Crystal Structure Of Soybean Beta-Conglycinin Beta
           Homotrimer (I122mK124W)
 pdb|1UIJ|D Chain D, Crystal Structure Of Soybean Beta-Conglycinin Beta
           Homotrimer (I122mK124W)
 pdb|1UIJ|E Chain E, Crystal Structure Of Soybean Beta-Conglycinin Beta
           Homotrimer (I122mK124W)
 pdb|1UIJ|F Chain F, Crystal Structure Of Soybean Beta-Conglycinin Beta
           Homotrimer (I122mK124W)
          Length = 416

 Score = 35.0 bits (79), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 12/69 (17%)

Query: 84  DMIHVPMSFDFFRSIASENNYLRF-------QDNSLSGDAPSTDKAIEKEMQELAKIG-- 134
           D+  +P ++ F  +  S  N+L F       Q N L+G+  +  + IE+++QELA  G  
Sbjct: 315 DVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSA 374

Query: 135 ---ERLLKK 140
              ERLLKK
Sbjct: 375 QDVERLLKK 383


>pdb|1IPK|A Chain A, Crystal Structures Of Recombinant And Native Soybean Beta-
           Conglycinin Beta Homotrimers
 pdb|1IPK|B Chain B, Crystal Structures Of Recombinant And Native Soybean Beta-
           Conglycinin Beta Homotrimers
 pdb|1IPK|C Chain C, Crystal Structures Of Recombinant And Native Soybean Beta-
           Conglycinin Beta Homotrimers
          Length = 416

 Score = 35.0 bits (79), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 12/69 (17%)

Query: 84  DMIHVPMSFDFFRSIASENNYLRF-------QDNSLSGDAPSTDKAIEKEMQELAKIG-- 134
           D+  +P ++ F  +  S  N+L F       Q N L+G+  +  + IE+++QELA  G  
Sbjct: 315 DVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSA 374

Query: 135 ---ERLLKK 140
              ERLLKK
Sbjct: 375 QDVERLLKK 383


>pdb|1IPJ|A Chain A, Crystal Structures Of Recombinant And Native Soybean
           Beta-Conglycinin Beta Homotrimers Complexes With
           N-Acetyl-D-Glucosamine
 pdb|1IPJ|B Chain B, Crystal Structures Of Recombinant And Native Soybean
           Beta-Conglycinin Beta Homotrimers Complexes With
           N-Acetyl-D-Glucosamine
 pdb|1IPJ|C Chain C, Crystal Structures Of Recombinant And Native Soybean
           Beta-Conglycinin Beta Homotrimers Complexes With
           N-Acetyl-D-Glucosamine
          Length = 416

 Score = 35.0 bits (79), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 12/69 (17%)

Query: 84  DMIHVPMSFDFFRSIASENNYLRF-------QDNSLSGDAPSTDKAIEKEMQELAKIG-- 134
           D+  +P ++ F  +  S  N+L F       Q N L+G+  +  + IE+++QELA  G  
Sbjct: 315 DVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSA 374

Query: 135 ---ERLLKK 140
              ERLLKK
Sbjct: 375 QDVERLLKK 383


>pdb|2Q1L|A Chain A, Design And Synthesis Of Pyrrole-Based, Hepatoselective
           Hmg-Coa Reductase Inhibitors
 pdb|2Q1L|B Chain B, Design And Synthesis Of Pyrrole-Based, Hepatoselective
           Hmg-Coa Reductase Inhibitors
 pdb|2Q1L|C Chain C, Design And Synthesis Of Pyrrole-Based, Hepatoselective
           Hmg-Coa Reductase Inhibitors
 pdb|2Q1L|D Chain D, Design And Synthesis Of Pyrrole-Based, Hepatoselective
           Hmg-Coa Reductase Inhibitors
 pdb|2Q6B|A Chain A, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 pdb|2Q6B|B Chain B, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 pdb|2Q6B|C Chain C, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 pdb|2Q6B|D Chain D, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 pdb|2Q6C|A Chain A, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 pdb|2Q6C|B Chain B, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 pdb|2Q6C|C Chain C, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 pdb|2Q6C|D Chain D, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 pdb|3BGL|A Chain A, Hepatoselectivity Of Statins: Design And Synthesis Of 4-
           Sulfamoyl Pyrroles As Hmg-Coa Reductase Inhibitors
 pdb|3BGL|B Chain B, Hepatoselectivity Of Statins: Design And Synthesis Of 4-
           Sulfamoyl Pyrroles As Hmg-Coa Reductase Inhibitors
 pdb|3BGL|C Chain C, Hepatoselectivity Of Statins: Design And Synthesis Of 4-
           Sulfamoyl Pyrroles As Hmg-Coa Reductase Inhibitors
 pdb|3BGL|D Chain D, Hepatoselectivity Of Statins: Design And Synthesis Of 4-
           Sulfamoyl Pyrroles As Hmg-Coa Reductase Inhibitors
 pdb|2R4F|A Chain A, Substituted Pyrazoles As Hepatselective Hmg-Coa Reductase
           Inhibitors
 pdb|2R4F|B Chain B, Substituted Pyrazoles As Hepatselective Hmg-Coa Reductase
           Inhibitors
 pdb|2R4F|C Chain C, Substituted Pyrazoles As Hepatselective Hmg-Coa Reductase
           Inhibitors
 pdb|2R4F|D Chain D, Substituted Pyrazoles As Hepatselective Hmg-Coa Reductase
           Inhibitors
 pdb|3CCT|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CCT|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CCT|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CCT|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CCW|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CCW|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CCW|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CCW|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CCZ|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CCZ|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CCZ|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CCZ|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CD0|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CD0|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CD0|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CD0|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CD5|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CD5|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CD5|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CD5|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CD7|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CD7|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CD7|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CD7|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CDA|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CDA|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CDA|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CDA|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CDB|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CDB|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CDB|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 pdb|3CDB|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
          Length = 441

 Score = 28.1 bits (61), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 30/61 (49%), Gaps = 16/61 (26%)

Query: 97  SIASENNYLRFQDNSLSGDA-------PSTDKAIEK------EMQELAKIGERLL-KKPV 142
           SIA  N Y+RFQ  S SGDA         T+KA+ K      EMQ LA  G     KKP 
Sbjct: 203 SIAGRNLYIRFQ--SRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPA 260

Query: 143 S 143
           +
Sbjct: 261 A 261


>pdb|1DQ8|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg And Coa
 pdb|1DQ8|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg And Coa
 pdb|1DQ8|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg And Coa
 pdb|1DQ8|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg And Coa
 pdb|1DQ9|A Chain A, Complex Of Catalytic Portion Of Human Hmg-Coa Reductase
           With Hmg-Coa
 pdb|1DQ9|B Chain B, Complex Of Catalytic Portion Of Human Hmg-Coa Reductase
           With Hmg-Coa
 pdb|1DQ9|C Chain C, Complex Of Catalytic Portion Of Human Hmg-Coa Reductase
           With Hmg-Coa
 pdb|1DQ9|D Chain D, Complex Of Catalytic Portion Of Human Hmg-Coa Reductase
           With Hmg-Coa
 pdb|1DQA|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg, Coa, And Nadp+
 pdb|1DQA|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg, Coa, And Nadp+
 pdb|1DQA|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg, Coa, And Nadp+
 pdb|1DQA|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg, Coa, And Nadp+
 pdb|1HW8|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Compactin (Also Known As Mevastatin)
 pdb|1HW8|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Compactin (Also Known As Mevastatin)
 pdb|1HW8|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Compactin (Also Known As Mevastatin)
 pdb|1HW8|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Compactin (Also Known As Mevastatin)
 pdb|1HW9|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Simvastatin
 pdb|1HW9|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Simvastatin
 pdb|1HW9|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Simvastatin
 pdb|1HW9|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Simvastatin
 pdb|1HWI|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Fluvastatin
 pdb|1HWI|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Fluvastatin
 pdb|1HWI|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Fluvastatin
 pdb|1HWI|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Fluvastatin
 pdb|1HWJ|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Cerivastatin
 pdb|1HWJ|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Cerivastatin
 pdb|1HWJ|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Cerivastatin
 pdb|1HWJ|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Cerivastatin
 pdb|1HWK|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Atorvastatin
 pdb|1HWK|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Atorvastatin
 pdb|1HWK|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Atorvastatin
 pdb|1HWK|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Atorvastatin
 pdb|1HWL|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Rosuvastatin (Formally Known As Zd4522)
 pdb|1HWL|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Rosuvastatin (Formally Known As Zd4522)
 pdb|1HWL|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Rosuvastatin (Formally Known As Zd4522)
 pdb|1HWL|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Rosuvastatin (Formally Known As Zd4522)
          Length = 467

 Score = 28.1 bits (61), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 30/64 (46%), Gaps = 16/64 (25%)

Query: 94  FFRSIASENNYLRFQDNSLSGDA-------PSTDKAIEK------EMQELAKIGERLL-K 139
              SIA  N Y+RFQ  S SGDA         T+KA+ K      EMQ LA  G     K
Sbjct: 213 LHTSIAGRNLYIRFQ--SRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDK 270

Query: 140 KPVS 143
           KP +
Sbjct: 271 KPAA 274


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.129    0.379 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,334,651
Number of Sequences: 62578
Number of extensions: 214403
Number of successful extensions: 406
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 402
Number of HSP's gapped (non-prelim): 9
length of query: 181
length of database: 14,973,337
effective HSP length: 93
effective length of query: 88
effective length of database: 9,153,583
effective search space: 805515304
effective search space used: 805515304
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 48 (23.1 bits)