Citrus Sinensis ID: 041086


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MEKKPKAGKKLPKKAASSDKEMKCAKKSIKTYKIYIFKVLNKSILILESRARHNIFEEFARYKKKPMITSWEIQTVGRLVLPGELVKHIVSEGTKAVTKFTS
ccccccccccccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEcccHHHHHHHHHHHHHHcccccc
****************************IKTYKIYIFKVLNKSILILESRARHNIFEEFARYKKKPMITSWEIQTVGRLVLPGELVKHIVSEGTKAVTKF**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKKPKAGKKLPKKAASSDKEMKCAKKSIKTYKIYIFKVLNKSILILESRARHNIFEEFARYKKKPMITSWEIQTVGRLVLPGELVKHIVSEGTKAVTKFTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone H2B.2 Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.probableQ6ZBP3
Histone H2B.1 Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.probableA3AGM4
Histone H2B.7 Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.probableQ9LZT0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NQB, chain D
Confidence level:very confident
Coverage over the Query: 30-102
View the alignment between query and template
View the model in PyMOL