Citrus Sinensis ID: 041160


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MALLQFNSFSSFSVLSTSQQQAYLSPSSIKTHQQNNSLFSFSATNTKDGLFSLSTHPRKFLCKPPQGKYVREDYLVKKKTAQEIQELVRGERNVPIIIDFYATWCGPCILMAQEIELLAVEYESSAMIVKVDTDDEYEFARDMQVRGLPTLFFISPDPNKDAIRTEGLIPIQMMRDIIDNEM
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHcccccccEEEEEEcccccccccccccccHHHHHHHHHHHc
********************************************************PRKFLCKPPQGKYVREDYLVKKKTAQEIQELVRGERNVPIIIDFYATWCGPCILMAQEIELLAVEYESSAMIVKVDTDDEYEFARDMQVRGLPTLFFISPDPNKDAIRTEGLIPIQMMRDIIDNEM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALLQFNSFSSFSVLSTSQQQAYLSPSSIKTHQQNNSLFSFSATNTKDGLFSLSTHPRKFLCKPPQGKYVREDYLVKKKTAQEIQELVRGERNVPIIIDFYATWCGPCILMAQEIELLAVEYESSAMIVKVDTDDEYEFARDMQVRGLPTLFFISPDPNKDAIRTEGLIPIQMMRDIIDNEM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin-like protein CITRX, chloroplastic Probable thiol-disulfide oxidoreductase that may play a role in plastid development and be involved in disease resistance.probableQ9M7X9
Thioredoxin-like protein CITRX, chloroplastic Probable thiol-disulfide oxidoreductase that may play a role in plastid development and be involved in disease resistance.probableQ8H2V6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 75-182
View the alignment between query and template
View the model in PyMOL
Template: 3UEM, chain A
Confidence level:confident
Coverage over the Query: 38-58,73-181
View the alignment between query and template
View the model in PyMOL